DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and blm

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:XP_017207538.1 Gene:blm ZFINID:ZDB-GENE-070702-5 Length:1450 Species:Danio rerio

Alignment Length:1396 Identity:315/1397 (23%)
Similarity:519/1397 (37%) Gaps:378/1397 (27%)


  Fly   201 LKPSLSAKLF--QSSRGFAK-RNPRKPLSRCVSSSSSTTSLS-SVPTDHHEELLDFETILIRKAQ 261
            |||......|  :||.|.:| ..|:|     |:.||...:.| ::|:       :||        
Zfish    38 LKPKPGGFCFKKKSSSGISKVEVPQK-----VTGSSVLANRSVNIPS-------NFE-------- 82

  Fly   262 EYKEKQQAIANNPMLASEHSKESIKTLVDDGWLRRNTKENTLDEEV-PFAEANNNSGTSKKTNFG 325
                    :..||:..|: ..|.:...|:........|.||::... |||               
Zfish    83 --------VTKNPVTFSQ-KPERVAPKVNFFTAPSKPKTNTVNPLANPFA--------------- 123

  Fly   326 LANLDLSKLKPTVKEEKVLQAKPDQMAIIQ--------ELQTDMNS-SMNQKPDHLNHTPPASSQ 381
                    |..|...:..::|.|...|:.:        ||:.|::. |.|:..|..:...|..|:
Zfish   124 --------LNKTPLVQSTIKALPKSAALPKDSTNDQTVELKHDISQLSFNEWDDLDDFETPVKSR 180

  Fly   382 --KSVA--PKNKPPPSEQETDSDSDSVVAESEEEQEPQEYRQLSKRRKIVSTASG-KVEVA--AP 439
              ..||  ...||..|:|.|.|...|...|::..:|.|....::..:.::|.|:| ..|.|  .|
Zfish   181 VASPVAGTSTKKPSVSDQNTSSSCSSKCEETKVNEESQATETITAPKDVLSAANGVSTETAEREP 245

  Fly   440 VEIPNKVEPETETFAQENPDFSADEDQDATYV--PENKKKDKAKRKQAAGKQKTTKPKA------ 496
            .:.|.|.....:...|.....|..||::..:.  |:..:|: .|....|.|.|..:|..      
Zfish   246 EDSPIKKSKRPKKSVQHTALLSDTEDEEIIHCVSPDTNQKN-FKSVAVAEKDKWGEPNVIDSDDC 309

  Fly   497 -------------EPKPKTEK-------KAKVKAEKKPKAEKKPRNSKKAIAVEPAPDPEEDERQ 541
                         .|.|..|:       |.|..:|....|.|| .:|:.|..:   |.|.:...:
Zfish   310 EENNHYEGFEDFIPPSPIPEEISLSVSDKEKSSSEPVTPANKK-ESSRSASGL---PAPLDQSAK 370

  Fly   542 PLNPED------LKYVLALEAGDITSVPRINVQDLE-EADATAQRYIRTFAAGPNPGLSEGSNIR 599
            .|...|      ::.:..|    :.::|...:..|. ..:...||..|...      |::|.:.|
Zfish   371 GLKGADDALFSVMESICCL----VDTIPEHELIALTCGTELLLQRAHRKRI------LAKGGSSR 425

  Fly   600 VDEKRAAARKKLEERIAAGKLNENFVTINIQKKKFVRGKKSVNFSKYKKQQWRHKKRVAALSGPD 664
            .....:.:......|...|....|..::.    ....||:     :..|..:..:|.:|::    
Zfish   426 TSHSDSVSTPGFLNRPTFGVTPSNLTSLT----PVTSGKR-----EGVKTGFSFRKSIASV---- 477

  Fly   665 MDMGGCDGGVLTCFQC--GGVGHFAQQCKVKGDSLLPLSAQLEEDPSPFPTLAEAQEMASQGAVV 727
            |.:|  |..|.....|  .||       :..|.:..|.|:          |...|......|::.
Zfish   478 MSVG--DESVFEDSDCIINGV-------ETPGGTWNPNSS----------TKISAGRDTFNGSIQ 523

  Fly   728 AHSRNISRLPQAANAAILQGDELNESEEDDQESSGDEEVQQHPDPNWSSDEMDVDFEALDAAVEA 792
            ..|:     |::...........|||             ....|..:|...:|......|::||.
Zfish   524 TLSK-----PESKTDKCYSRLSFNES-------------SNQTDLFYSPKRVDSGSRNADSSVEI 570

  Fly   793 SLSQPVSQEKAASPIKTYV----------GHKIPEEFLKQAGLDTTASSSNRS-------QHGG- 839
            :::...|....|.|:..::          .:.||:.:.:.   .:...|.|.|       |.|| 
Zfish   571 NIAGSSSLRTGAEPVDDFLLDDFDIDDFDENDIPDYYEEP---PSVLESRNNSGVKTPSVQEGGS 632

  Fly   840 ---------------------VKPLYDLLPDGSVQDT--------TPEVLEALH-MFGHTNFRKG 874
                                 .:|||    .....|.        :||:::..| .||...||..
Zfish   633 SKSFERKTFTPPAPKSIKTPNPEPLY----RNPAHDRFRGFNFPHSPEMMKIFHKKFGLHQFRFN 693

  Fly   875 QDRAIMRTLSGLSSLVTLSTGSGKSLCYQLPAYLYSRKVGAITLVISPLVSLMEDQVTGVPHF-L 938
            |..||..:|.|..:.|.:.||.||||||||||.:.:    .:|:|||||.||:.|||..:... :
Zfish   694 QLEAINASLLGEDTFVLMPTGGGKSLCYQLPACVSA----GVTVVISPLRSLIVDQVQKLTTLDI 754

  Fly   939 RAHCLHTNQTAPQRMKIQQMIANGE--IDILLVSPEAVVAGERATGFGAILRQLPPIAFACIDEA 1001
            .|..|..::...:..:|...::..:  |.:|..:||.|.|..|.......|.:...:|...||||
Zfish   755 CATSLSGDKKDSEAARIYMQLSRKDPAIKLLYATPEKVCASGRMISALQNLYERGLLARLVIDEA 819

  Fly  1002 HCVSQWSHNFRPSYLMICKVLRKNLGVRTVLGLTATATLPTRVSIINHLGISDGERGIISDIPLP 1066
            ||||||.|:|||.|..:.: ||:......::.||||||...:..|:|.|.::..:  :.:.....
Zfish   820 HCVSQWGHDFRPDYKRLHE-LRRMFPNVPIMALTATATPRVQKDILNQLAMTRPQ--VFTMSFNR 881

  Fly  1067 DNLVLSV--SKDENRDAALLQLLNSERFEPCQSIIIYCTRRDECERIAGFIRTCVQDRREPTQDQ 1129
            :||..||  .|.:..|...:|.:  :::.|..|.|:||..|::|:.:|..:              
Zfish   882 NNLKYSVLPKKPKKVDEECIQWI--KKYYPRDSGIVYCLSRNDCDTLADSL-------------- 930

  Fly  1130 TKKRKRVNWQAEPYHAGMPASRRRTVQKAFMSNE-LRIVVATIAFGMGINKPDIRAVIHYNMPRN 1193
                :|....|..||||:..|.|..||..:::.: .:::.|||||||||:|||:|.|||.::|::
Zfish   931 ----QRAGIAALAYHAGLSDSDREYVQNKWINQDGCQVMCATIAFGMGIDKPDVRYVIHASLPKS 991

  Fly  1194 FESYVQEIGRAGRDGLPSHCHLF--------------LDAKGGDQS------------------- 1225
            .|.|.||.|||||||..|||.||              :|..|..||                   
Zfish   992 VEGYYQESGRAGRDGEISHCVLFYSYSDVIRIKRLIAMDKDGNQQSKATHINNLHSMVHFCENVA 1056

  Fly  1226 ELRR---------HVYSNSI-------------------DRHV---IRKLLQKIFVPCSCDK--- 1256
            |.||         |.::.|.                   .|:|   ::|:.:  ||..:|:|   
Zfish  1057 ECRRIQLLAYFGEHTFNTSFCKEHPEVICDNCARPNKYKSRNVTDDVKKIAR--FVQDNCEKVGN 1119

  Fly  1257 ---EASKRTALPIPLEGDGPRVHMCPGHE----------IGFSVEK-------------TVEMLD 1295
               :::::..|.:.:     .|.:..|.:          :|.:..|             .|.|.|
Zfish  1120 RYGKSAQQNRLTLNM-----LVEIFLGSKSARIQTGMFGVGAAYSKHNAERLFKKLVLDNVLMED 1179

  Fly  1296 IPAENISTLLCYMELDPRWCISVLSSAYVMAKVISYGGPKYLKHAAKECPPLAMAIALQIRDKTF 1360
            :...|....:.|:...|: .:|||:....:....:.......||.|..|            :|..
Zfish  1180 LYITNSGQAVAYISAGPK-AMSVLNGCMQVEFHETESASSIRKHRASVC------------EKVS 1231

  Fly  1361 KEDSNIIEF--SVTDIAAGIGWNSGVVKYQL 1389
            |.:..:.:.  .:.|:...:|...|:..|.:
Zfish  1232 KREEMVKKCLGELNDLCKKLGKVFGIHYYNI 1262

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 130/375 (35%)
DEAD 872..1039 CDD:278688 64/170 (38%)
HELICc 1073..1216 CDD:238034 54/146 (37%)
blmXP_017207538.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.