DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and wrn

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:XP_009302246.2 Gene:wrn ZFINID:ZDB-GENE-070702-2 Length:1387 Species:Danio rerio

Alignment Length:844 Identity:234/845 (28%)
Similarity:340/845 (40%) Gaps:235/845 (28%)


  Fly   513 KPKAEKKPRNSKKAIAVEPAPDPE-------EDERQPLN--PEDLKYVLALEAG-----DITSVP 563
            ||:.|......||.:..:..|..|       ..||...:  .|||:  .||.:|     |:...|
Zfish    13 KPQDEHTSGTYKKNVLEDHLPYLEFGGTVVYSQERHDCSFLSEDLR--SALSSGSAVGFDLEWPP 75

  Fly   564 RIN---------VQDLEEADATAQRYIRTFAAGPNPGLS---EGSNI------------------ 598
            ...         ||.....|.....:|.:.:..| |||.   |..||                  
Zfish    76 SFTKGKTKKVAMVQLCASEDKCYLFHISSMSGFP-PGLKMFLEDENIMKVGVGIEGDKWKLLSDY 139

  Fly   599 -----RVDEKRAAARKKLE--ERIAAGKLNENFVTINIQKKKFVRGKKSVNFSKYKKQQWRHKKR 656
                 .:.:....|.:||.  |:.:...|.::.:...:.|.|.||.....:||..:.|     ||
Zfish   140 DIKLKNIVDLSDLANEKLRCCEKWSLDGLVKHLLKKQLFKDKLVRCSHWDDFSLTEDQ-----KR 199

  Fly   657 VAALSG----------PDMDMGGCDGG----------VLTC------------FQC-GGVGHFAQ 688
            .||...          .:| :.||.|.          .:.|            ..| .|.|....
Zfish   200 YAATDAYAGLLIYQKLQEM-ISGCSGSSAPSLKERVLKIACDLKDLADHIPNELDCTDGAGRLVD 263

  Fly   689 ---------QCKVKGDSLLPLSAQLEEDPSP-------------FPTLAEAQEMASQGAVVAHSR 731
                     :| |..::..|....:||.|||             .||..|.          :||:
Zfish   264 DLSQTLTSLRC-VLSNANKPTEQLVEEKPSPGLILDDTSSHHEGVPTTEEQ----------SHSQ 317

  Fly   732 ---NISRLPQ--AANAAILQGDELNESEEDDQESSGDEEV-----QQH----PDPNWSSDEMDVD 782
               |..|.||  .|.:..:...||...||..::...:||.     .||    .|.|.:..:.:.|
Zfish   318 CVENPGRPPQRECAMSLDISEYELQMLEEQARQEQLEEECILAFQTQHASGPQDLNATESDEEFD 382

  Fly   783 FEALDAAVEASLSQPVSQEKAASPIKTYVGHKIPEEFLKQAGLDTTASSSNRSQHGGVKPLYDLL 847
            .|.:               |.|..|:     ||....:.|:|.:........::..|:       
Zfish   383 DEMM---------------KCADDIE-----KINNAQMPQSGAEDEDEDVEENEEEGL------- 420

  Fly   848 PDGSVQDTTPEVLEALHM-FGHTNFRKGQDRAIMRTLS-GLSSLVTLSTGSGKSLCYQLPAYLYS 910
             |.|:....||.::.|.| |||.:|:..|.:.|...|: ...:||.::||.|||||:|.|. :|.
Zfish   421 -DSSIPQPVPEQIKCLKMFFGHHSFKPVQWKVIQSILTERRDNLVVMATGYGKSLCFQFPP-VYC 483

  Fly   911 RKVGAITLVISPLVSLMEDQV-----TGVPHFLRAHCLHTNQTAPQRMKIQQMIANGEIDILLVS 970
            :   .|::|||||::||||||     :.:|    |..|.:.||    ..:.:.:..|:..::.::
Zfish   484 Q---TISVVISPLIALMEDQVLQLTMSNIP----ACFLGSAQT----KNLNEQVKRGDFRVVYMT 537

  Fly   971 PE-------AVVAGERATGFGAILRQLPPIAFACIDEAHCVSQWSHNFRPSYLMICKVLRKNLGV 1028
            ||       .:|..:|..|...|          .:|||||:|||.|:||.:|..:.| |:|||..
Zfish   538 PEFCSGNIPLLVQLDRTVGLSLI----------AVDEAHCISQWGHDFRSAYRELGK-LKKNLPT 591

  Fly  1029 RTVLGLTATATLPTRVSIINHLGISDGERGIIS-DIPLPDNLVLSVSK---DENRDAALLQLLNS 1089
            ...|.|||||:...|..||..|.:.:......| |.|   ||.|.|::   |..:|  |.:.|..
Zfish   592 VPFLALTATASPSIRDDIIKSLHLINPMITCTSFDRP---NLYLDVNRKSGDVIQD--LKRFLVK 651

  Fly  1090 ER---FEPCQSIIIYCTRRDECERIAGFIRTCVQDRREPTQDQTKKRKRVNWQAEPYHAGMPASR 1151
            ::   :|...|.|:||..:.|.||:                  |....:::.....||||:...:
Zfish   652 KKGGGYEFEGSAIVYCPSKKEAERV------------------TTALFKLDIPCGVYHAGLSIKQ 698

  Fly  1152 RRTVQKAFMSNELRIVVATIAFGMGINKPDIRAVIHYNMPRNFESYVQEIGRAGRDGLPSHCHL 1215
            ||..|..||.:|::.||||:||||||||.|||.||||..|:..|||.|||||||||||||.||:
Zfish   699 RRETQHQFMRDEIQCVVATVAFGMGINKSDIRKVIHYGAPKEMESYYQEIGRAGRDGLPSACHV 762

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 139/374 (37%)
DEAD 872..1039 CDD:278688 62/180 (34%)
HELICc 1073..1216 CDD:238034 62/150 (41%)
wrnXP_009302246.2 WRN_exo 48..217 CDD:176653 35/177 (20%)
DEXDc 433..901 CDD:331760 140/377 (37%)
HRDC 1045..1116 CDD:322002
HTH_40 1155..1242 CDD:316965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.