DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and recql4

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:XP_001920631.5 Gene:recql4 ZFINID:ZDB-GENE-091112-2 Length:1459 Species:Danio rerio

Alignment Length:1703 Identity:547/1704 (32%)
Similarity:789/1704 (46%) Gaps:379/1704 (22%)


  Fly     9 KYQKYKLRVKVWEKDFKKKNGRVPSKYDIRDASQEIRDSYKMYYKLKTSFLEETLNDVLSEDGYD 73
            :|...|:.:|.||:.|.:.|.|.|:|.||..|.:|.|..||.|..||.:   :..||.:.|....
Zfish     3 RYNDVKILLKKWEQSFFQTNNRKPNKDDIDKAPEETRQLYKEYRSLKVA---KERNDAVKESQTK 64

  Fly    74 ILEMSQASDFGVSMLDQDVSLNEGPQLPLDISALVGPQSSGNLEEIPQSVEGSFSNLIDLPNRQV 138
            ..| ||:|..|.......::..   .||:.:..|    ||.:.|.:..|.:        ....::
Zfish    65 PPE-SQSSTDGSGCWGSHLNRK---NLPVALPKL----SSDDKETLKASAQ--------YFGMKL 113

  Fly   139 LTNL--VNRDENHVIRKFEAVEELP-------INQNAWGLNVSKKPPAP----PQPVEASKSAPG 190
            ..||  :.::.:..::|.......|       ::.||...:|....|.|    |.|         
Zfish   114 KNNLGGLTKERSFSLKKAATPRRTPQKLIKDTVDSNAAATDVESHTPKPANTCPDP--------- 169

  Fly   191 HGKQPKAGASLKPSLSAKL-FQS--SRGFAKRNPRKPLSRCVSSS------------SSTTSLSS 240
                     |..|..:||: |:.  |..|....|.||.|..|.|:            |.|...||
Zfish   170 ---------SAAPVQAAKMDFEDDPSDPFPSITPSKPCSTVVGSAQKSVERVQFLRQSITRRFSS 225

  Fly   241 VPTDHHEELLDFETILIRKAQEYKEKQQAIANNPMLASEHSKESIKTLVDDGWLRRNTKENTLDE 305
            |.:........|:        |.:|.|:.:|.|..||.:.     |:.:......::....|..|
Zfish   226 VDSGWLARCQVFD--------EVEEPQKPVAGNSELAKDE-----KSFLQPAVGSKSGSPGTHGE 277

  Fly   306 EVPFAEANNNSGTSKKTNFGLANLDLSKLKPTVKEEKVLQAKPDQMAIIQELQTDMNSSMNQKPD 370
            .|....:.|...|       .:|..|.:.|.::.||              |.|.|:.:|..:...
Zfish   278 RVSHKNSPNEGQT-------FSNTLLGRKKSSLPEE--------------EAQIDLVTSSVRNNV 321

  Fly   371 HLN--HTPPASSQKSVAPKNKPPPSEQETDSDSDSVVAESEEEQEPQEYRQLSKRRKIVSTASGK 433
            .||  ...|.:..:.|:.|:.|            .:..:.|...|..|:...:|:||   |.:.|
Zfish   322 VLNAISGSPGTHGERVSLKSSP------------KLRVDDENLSEEPEFTPNTKQRK---TKARK 371

  Fly   434 VEVAAPVEIPNKVEPETETFAQENPDFSADEDQDATYVPENKKKDKAKRKQAAGKQKTTKPKAEP 498
            .:.:.......|.:.|    |....|....|:::...    ||:.|.|:.:.||:.       :|
Zfish   372 DQDSGAKTKGRKRQRE----ADNGDDMDESEEKEGGV----KKRRKTKKGETAGED-------QP 421

  Fly   499 KPKTEKKAKVKAEKKPKAEKKPRNSKKAIAVEPAPDPEEDERQPLNPEDLKYVLALEAGDITSVP 563
            |.:.:||.||:.:....:.:..:..|:|:       |:|:                ..|::    
Zfish   422 KKRGKKKGKVEEDDDDGSSENKKPQKRAM-------PQEN----------------LLGEV---- 459

  Fly   564 RINVQDLEEADATAQRYIRTFAAGPNPGLSEGSNIRVDEKRAAARKKLEERIAAGKLNENFVTIN 628
                 |.|||.|.|.....|....|... ::|                           |||.||
Zfish   460 -----DEEEARAAAYAMKNTVRVRPTKN-TDG---------------------------NFVKIN 491

  Fly   629 IQKKKFVRGKKSVNFSKYKKQQWRHKKRVAALSGPDMDMG-----GCDGGVL----TCFQCGGVG 684
            ::||..|:| .::..:..:||.:..|.:   |.|.....|     |..||..    ||::|||.|
Zfish   492 LKKKSHVKG-FALRGAALRKQMYMQKFQ---LKGERFGGGFGRGRGRFGGFNRQGDTCYKCGGTG 552

  Fly   685 HFAQQCKVKGDSLLPLSAQLEEDPSP-------FPTLAEAQEMASQGAVVAHSRNISRLPQAANA 742
            |:||.|:.|    :|::...|:..:|       .|||.|    .::......|..|...|.|   
Zfish   553 HWAQDCRGK----VPVNTSAEQQETPVEEEEFELPTLEE----VARATGTLRSEPIVAPPSA--- 606

  Fly   743 AILQGDELNESEEDDQESSGDEEVQQHPDPNWSSDEMDVDFEALDAAVEASLSQPVSQEKAASPI 807
               .||   .||:::|                            .|.:..::.:|..:..|..| 
Zfish   607 ---DGD---SSEKEEQ----------------------------GAEILLNIIRPDYERPAPPP- 636

  Fly   808 KTYVGHKIPEEFLKQAGLDTTASSSNRSQHGGVKPLYDLLPDGSVQDTTPEVLEALHMFGHTNFR 872
                    |.|                       |||.|..||.|||..|||.|||..||:.:||
Zfish   637 --------PME-----------------------PLYKLKDDGKVQDVPPEVYEALRDFGYKSFR 670

  Fly   873 KGQDRAIMRTLSGLSSLVTLSTGSGKSLCYQLPAYLYSRKVGAITLVISPLVSLMEDQVTGVPHF 937
            .||:.||||.|||||:||.||||.|||||||||||||:::..:||||:|||||||:||::|:|..
Zfish   671 PGQEAAIMRILSGLSTLVVLSTGMGKSLCYQLPAYLYAQRSKSITLVVSPLVSLMDDQLSGLPPK 735

  Fly   938 LRAHCLHTNQTAPQRMKIQQMIANGEIDILLVSPEAVVAGERATGFGAI--LRQLPPIAFACIDE 1000
            |:|.|:|:|.:|.||....:.:..|::.:||:||||:|.|.. :|.|.:  ..||||:|||||||
Zfish   736 LKAACIHSNMSAKQREAAIEKVKAGQVHVLLLSPEALVGGGH-SGSGCLPPADQLPPVAFACIDE 799

  Fly  1001 AHCVSQWSHNFRPSYLMICKVLRKNLGVRTVLGLTATATLPTRVSIINHLGISDGERGIISDIPL 1065
            |||||:|||||||.||.:|||||..||||.:|||||||||.|.:.|..||.|||.:...:....:
Zfish   800 AHCVSEWSHNFRPCYLRLCKVLRDRLGVRCLLGLTATATLSTALDIARHLDISDEDGIAVRSAAV 864

  Fly  1066 PDNLVLSVSKDENRDAALLQLLNSERFEPCQSIIIYCTRRDECERIAGFIRTCVQ---------- 1120
            |.||.||||.|.::|.||:.||..|||....|:|:|||||:|..|||..:|||:|          
Zfish   865 PHNLQLSVSMDRDKDQALVSLLKGERFGALDSVIVYCTRREETSRIAALLRTCLQGVMLRESSKH 929

  Fly  1121 -----------DRREPTQDQTKKRKRVNWQAEPYHAGMPASRRRTVQKAFMSNELRIVVATIAFG 1174
                       .:::....:.|.||.:.|.||.||||:.||.||.||..||..|||:||||:|||
Zfish   930 TALQEDDDNPVGKKKKALARKKIRKPLKWIAEAYHAGLSASERRRVQNNFMCGELRVVVATVAFG 994

  Fly  1175 MGINKPDIRAVIHYNMPRNFESYVQEIGRAGRDGLPSHCHLFLDAKGGDQSELRRHVYSNSIDRH 1239
            ||::|.|:|.:||||||::|||||||||||||||.|:|||||||.:|||..|||||:|::::|.:
Zfish   995 MGLDKSDVRGIIHYNMPKSFESYVQEIGRAGRDGHPAHCHLFLDPEGGDLHELRRHIYADTVDYY 1059

  Fly  1240 VIRKLLQKIFVPCSCDK------------EASKRTALPIPLEGDG---------------PRVH- 1276
            .::||:||:|.||.|.:            |.|....|.:.|..|.               |:.| 
Zfish  1060 TVKKLVQKVFPPCKCRQIQQKQQDLAQAAEVSDSELLEMELCDDSDPHQNEIPTLTHQQTPQTHT 1124

  Fly  1277 -----------------MCPGHEIGFSVEKTVEMLDIPAENISTLLCYMELDPRWCISVLSSAYV 1324
                             .|..||....:::|||.|||..|::.|||||:||.|:..:.:|.....
Zfish  1125 PEETEERPQLSDECVQRFCHTHERAIPMQETVEALDITEESLETLLCYLELHPQQWVELLHPTLS 1189

  Fly  1325 MAKVISYGGPKYLKHAAKECPPLAMAIALQIRDKTFKEDSNIIEFSVTDIAAGIGWNSGVVKYQL 1389
            :.|:..||||:.|:..||.|.|:|:.:|.:.......:..:.:||.|.::|..:||...:||..|
Zfish  1190 VCKLQCYGGPQQLRKIAKLCAPVAVVLARRRMAGERVQSCDALEFDVVELADTMGWQLPLVKRGL 1254

  Fly  1390 KDLEWVKVNGY---PKRSPITVSFYDLGFRIKVPGDFTESEIDNALDTLYTRSVKQERTQLIQLQ 1451
            :.|:|....|.   ..||.:.|.|..|.|..:..||.|..|:|.....|:.|...||.|||.||:
Zfish  1255 RQLQWGSDTGSYGGTGRSGVHVEFSALSFYFRSYGDLTADELDAVCAFLHGRVKTQENTQLYQLK 1319

  Fly  1452 YVAHGLAAVAYSSCGQCCNADFPQDRGEQLKAIVRNYFANDYPQDLELE---IEPSNVPDE---- 1509
            .......:|||.:|..|.: |..:.|.:.||.::.:||  |..::|||.   :|..:..:|    
Zfish  1320 TCFRAFRSVAYRNCSLCLD-DLEESRSQALKDLLSDYF--DKRRNLELSKQCLEDEHDEEEELNK 1381

  Fly  1510 --------NIIDDVHALINMYPDNTFTGRNIARIFHGIMSPNYPAVIWGR-CKFWRAHVKVDFNR 1565
                    .|..|:.|.:....|..|:||.:|||||||.||.|||.::|| .:|||.:::.|||.
Zfish  1382 CKMRDWETQICADIRAFLCSRSDEKFSGRAVARIFHGIGSPCYPAQVYGRDRRFWRKYIQFDFNE 1446

  Fly  1566 ILHLANMAIIKRR 1578
            |:.||...||:.|
Zfish  1447 IIRLATQEIIRTR 1459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 210/377 (56%)
DEAD 872..1039 CDD:278688 106/169 (63%)
HELICc 1073..1216 CDD:238034 85/164 (52%)
recql4XP_001920631.5 Drc1-Sld2 5..>186 CDD:314562 50/218 (23%)
PLN02341 289..>460 CDD:333273 46/254 (18%)
ZnF_C2HC 544..559 CDD:197667 10/15 (67%)
RecQ 664..>1040 CDD:223588 211/377 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C338388370
eggNOG 1 0.900 E1_COG0514
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 670 1.000 Inparanoid score I697
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D367596at33208
OrthoFinder 1 1.000 FOG0004747
OrthoInspector 1 1.000 T1054041
orthoMCL 1 0.900 OOG5_131869
Panther 1 1.100 LDO PTHR13710
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5620
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.