DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and recql5

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:XP_005164331.1 Gene:recql5 ZFINID:ZDB-GENE-071214-1 Length:933 Species:Danio rerio

Alignment Length:435 Identity:141/436 (32%)
Similarity:208/436 (48%) Gaps:99/436 (23%)


  Fly   866 FGHTNFR-KGQDRAIMRTLSG-LSSLVTLSTGSGKSLCYQLPAYLYSRKVGAITLVISPLVSLME 928
            ||...|| :.|:.|:...|.| ....|.:.||:||||||||||.:.|    .:|||||||::|::
Zfish    12 FGFEKFRSRQQEEAVNALLQGDRDVFVCMPTGAGKSLCYQLPALMAS----GVTLVISPLIALIQ 72

  Fly   929 DQV-----TGVPHFLRAHCLHTNQTAPQRMKIQQMIANGE-----IDILLVSPEAVVAGERATGF 983
            |||     ..||    |..:::.....:|   :|::|:.|     :.:|.::||.|.    :..|
Zfish    73 DQVEHLKALNVP----ARSINSKLPLAER---RQILADLESETPRLKLLYITPEMVA----SPSF 126

  Fly   984 GAILRQLPP---IAFACIDEAHCVSQWSHNFRPSYLMICKVLRKNLGVRTVLGLTATATLPTRVS 1045
            ..:|..|..   :.:..:|||||||||.|:|||.||.:..:..:..|:|.: .|||||  |.||.
Zfish   127 QPVLSSLSSRGLLGYLAVDEAHCVSQWGHDFRPDYLKLGDLRSRLQGIRCI-ALTATA--PKRVK 188

  Fly  1046 IINHLGISDGERGIISDIPLPDNLVLSV---SKDENRDAALLQLLNSERFEPCQSI--------- 1098
                   .|.||    .:.|...||.|.   .|:...|.....||.    ||...:         
Zfish   189 -------EDIER----SLRLRSPLVFSTPVFRKNLKYDVIFRDLLP----EPYVHLLAFAKEALG 238

  Fly  1099 ---------IIYCTRRDECERIAGFIRTCVQDRREPTQDQTKKRKRVNWQAEPYHAGMPASRRRT 1154
                     |:||..|:.||.:|                  .|..::...|:|||||:.:..|..
Zfish   239 GNTAEKGCGIVYCRTRESCEEVA------------------HKLTKLGIAAKPYHAGLKSGDRSE 285

  Fly  1155 VQKAFMSNELRIVVATIAFGMGINKPDIRAVIHYNMPRNFESYVQEIGRAGRDGLPSHCHLFLDA 1219
            .|..:|::::.|:||||:||||::|.::|.|:|:|:.::..||.||.||||||||||.|.::...
Zfish   286 NQADWMADKVPIIVATISFGMGVDKANVRFVVHWNLAKSLASYYQESGRAGRDGLPSSCRIYYSP 350

  Fly  1220 KGGDQSELRRHVYSNSIDRHVIRKLLQKIFVPCSCDKEASKRTAL 1264
            |..||...            :|||.:.:.......:||..|...|
Zfish   351 KDRDQLNF------------LIRKEISRKQEKRGSEKEQDKAPIL 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 131/388 (34%)
DEAD 872..1039 CDD:278688 66/182 (36%)
HELICc 1073..1216 CDD:238034 52/164 (32%)
recql5XP_005164331.1 DEXDc 12..217 CDD:214692 81/234 (35%)
DEAD 22..189 CDD:278688 68/192 (35%)
HELICc 211..347 CDD:238034 51/158 (32%)
RecQ_Zn_bind 352..420 CDD:292742 9/45 (20%)
RecQ5 629..755 CDD:284397
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.