DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and recql

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:XP_005164818.1 Gene:recql ZFINID:ZDB-GENE-050809-134 Length:798 Species:Danio rerio

Alignment Length:515 Identity:155/516 (30%)
Similarity:231/516 (45%) Gaps:127/516 (25%)


  Fly   784 EALDAAVEASLSQPVSQEKAASPIKTYVGHKIPEEFLKQAGLDTT----------ASSSNRSQHG 838
            |.|| :|||.|..              |..:|.|...||..|::.          |.||.:....
Zfish     9 EELD-SVEAELEM--------------VELQISELLEKQTRLNSRKNKLLKVLEGACSSAQPSGS 58

  Fly   839 GVKPLYDLLPDGSVQDT----------TPEV-LEALHMFGHTNFRKGQDRAIMRTLSGLSSLVTL 892
            |..|....    |.||.          :.|| :...::|..:.||..|..||..::||....:.:
Zfish    59 GKTPKSSF----SKQDLQHYEDSDFSWSKEVQVNLCNIFQLSKFRPLQRAAINLSMSGKDLFLVM 119

  Fly   893 STGSGKSLCYQLPAYLYSRKVGAITLVISPLVSLMEDQV-----TGVPHFLRAHCLHTNQTAPQR 952
            .||.|||||||||| |.|:   ..||||:|||||||||:     ..||    |..|:.:.:....
Zfish   120 PTGRGKSLCYQLPA-LCSK---GFTLVIAPLVSLMEDQLMYLQSVNVP----AVTLNASSSKEDS 176

  Fly   953 MKIQQMIA--NGEIDILLVSPEAVVAG-------ERATGFGAILRQLPPIAFACIDEAHCVSQWS 1008
            .:|...:.  |....:|.|:||.:...       |:|...|.:.|       ..:||.||.|||.
Zfish   177 KRILAGMTDKNSPFKLLYVTPEKIAKSKLLMSKLEKAFNMGLLAR-------IAVDEVHCCSQWG 234

  Fly  1009 HNFRPSYLMICKVLRKNLGVRTVLGLTATATLPTRVSIINHLGISDGERGIISDIPLP------- 1066
            |:|||.|.:: .:|::......::|||||||...         :.|.::.:....|:.       
Zfish   235 HDFRPDYKLL-GILKRQFPNVPLIGLTATATSNV---------LKDCQKILCVQEPVTLTAPFNR 289

  Fly  1067 DNLVLSVSKDENRD-----AALLQLLNSERFEPCQSIIIYCTRRDECERIAGFIRTCVQDRREPT 1126
            .||...|...:|.|     |:|::    .|::. ||.|:|...:.:.|.:|              
Zfish   290 PNLYYEVRFKDNEDCTDQIASLIR----GRYKN-QSGIVYVFSQKDAEVVA-------------- 335

  Fly  1127 QDQTKKRKRVNWQAEPYHAGMPASRRRTVQKAFMSNELRIVVATIAFGMGINKPDIRAVIHYNMP 1191
               |:.:|| :..|:||||.|..|.:..|.:.:.|.::::||||:||||||:|.|:|.|||:.:.
Zfish   336 ---TELQKR-DIVAQPYHANMEPSHKSLVHQRWSSKKIQVVVATVAFGMGIDKADVRFVIHHTIS 396

  Fly  1192 RNFESYVQEIGRAGRDGLPSHCHLFLD------------AKGGDQSELRRHV-YSNSIDR 1238
            ::.|:|.||.||||||..|:.|.:|..            .:...|.:|...| |..::||
Zfish   397 KSIENYYQESGRAGRDDSPADCIVFFGFMDIFRISTMVVMENTGQQKLHNMVAYCQNVDR 456

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 126/380 (33%)
DEAD 872..1039 CDD:278688 66/181 (36%)
HELICc 1073..1216 CDD:238034 52/148 (35%)
recqlXP_005164818.1 DEXDc 89..542 CDD:331760 132/417 (32%)
GTP_EFTU 599..>734 CDD:332590
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.