DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and recql

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_001016316.1 Gene:recql XenbaseID:XB-GENE-1017313 Length:558 Species:Xenopus tropicalis

Alignment Length:536 Identity:157/537 (29%)
Similarity:239/537 (45%) Gaps:127/537 (24%)


  Fly   777 DEMDVDFEALDAAVEASLSQPVSQEKAASPIKTYVGHKIPEEFLKQAGLDTTASSSNRSQHGGVK 841
            ||::.....|. |||..|.:.:.:::.....|..:..|| :...:.:|..|:|...:.:::...:
 Frog    11 DELESVSSELQ-AVEIQLQELLERQQELIQRKRLLNKKI-QRLSEDSGPGTSAGGGDSAENWQKE 73

  Fly   842 PLYDLLPDGSVQDTTPEVLEALHMFGHTNFRKGQDRAIMRTLSGLSSLVTLSTGSGKSLCYQLPA 906
               |.|....::|.      ..:.|...:||..|...|..|::|....:.:.||.||||||||||
 Frog    74 ---DFLWSQKIRDA------LCNSFQLRSFRSLQLETINATMAGRDVFLIMPTGGGKSLCYQLPA 129

  Fly   907 YLYSRKVGAITLVISPLVSLMEDQV-----TGV-----------PHFLRAHCLHTNQTAPQRMKI 955
            ....    ..||||.|||||||||:     .||           .|....|...||:        
 Frog   130 VCSD----GFTLVICPLVSLMEDQLMVLDRLGVSATSLNASSSKEHVKWVHGEMTNK-------- 182

  Fly   956 QQMIANGEIDILLVSPEAVVAG-------ERATGFGAILRQLPPIAFACIDEAHCVSQWSHNFRP 1013
                 |..:.:|.|:||.:...       |:|...|.:.|       ..:||.||.|||.|:|||
 Frog   183 -----NSRLKLLYVTPEKIAKSKLFMSRLEKAYQAGLLAR-------VAVDEVHCCSQWGHDFRP 235

  Fly  1014 SYLMICKVLRKNLGVRTVLGLTATATLPTRVSIINHLGISDGERGIISDIPLP---------DNL 1069
            .|..: .:|::......::|||||||        .|: :.|.::  |..:|.|         .||
 Frog   236 DYKTL-GILKRQFPNSPLIGLTATAT--------THV-LKDAQK--ILCVPKPLTFTASFNRPNL 288

  Fly  1070 VLSV----SKDENRDAALLQLLNSERFEPCQSIIIYCTRRDECERIAGFIRTCVQDRREPTQDQT 1130
            ...|    |..::..|.:::|:|| |:.. ||.||||..:.:.|.:                  |
 Frog   289 FYEVRLKPSSSQDFIADIVKLINS-RYRG-QSGIIYCFSQKDSEHV------------------T 333

  Fly  1131 KKRKRVNWQAEPYHAGMPASRRRTVQKAFMSNELRIVVATIAFGMGINKPDIRAVIHYNMPRNFE 1195
            ...:::..:|..|||.|....:..|...:.:||::|||||:||||||:|||:|.|||::|.::.|
 Frog   334 MSLQKLGIRAGTYHANMEPRDKTKVHTKWTANEIQIVVATVAFGMGIDKPDVRFVIHHSMSKSME 398

  Fly  1196 SYVQEIGRAGRDGLPSHCHLFLDAKGGD--------------QSELRRHV-YSNSIDRHVIRKLL 1245
            :|.||.||||||...:.|.|:...  ||              |.:|...| |..|.||  .|::|
 Frog   399 NYYQESGRAGRDDARADCILYYGF--GDIFRISSMVVMENVGQKKLYEMVGYCQSPDR--CRRVL 459

  Fly  1246 -----QKIFVPCSCDK 1256
                 .:::....|:|
 Frog   460 IAQHFDEVWDSAKCNK 475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 128/390 (33%)
DEAD 872..1039 CDD:278688 64/190 (34%)
HELICc 1073..1216 CDD:238034 54/147 (37%)
recqlNP_001016316.1 SKA2 <4..56 CDD:302619 10/47 (21%)
recQ_fam 83..539 CDD:129701 142/460 (31%)
DEAD 95..260 CDD:278688 64/190 (34%)
HELICc 287..419 CDD:238034 56/152 (37%)
RecQ_Zn_bind 424..480 CDD:292742 12/55 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.