DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and Blm

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_524319.2 Gene:Blm FlyBaseID:FBgn0002906 Length:1487 Species:Drosophila melanogaster

Alignment Length:1684 Identity:343/1685 (20%)
Similarity:554/1685 (33%) Gaps:622/1685 (37%)


  Fly     2 DDSVFKLKYQKY---------KLRVKVWEKDFKKKNGRVPSKYDIRD-------ASQEIRDSYKM 50
            |....|||...|         ||..|.:.:|..||    |:..|:..       |.:..|||.|.
  Fly    77 DPRTAKLKKHTYLDLSVSPLAKLSAKKYARDSPKK----PTSLDLSVSPLAELLAKKSDRDSPKK 137

  Fly    51 YYKLKTSFLEETLND--VLSEDGYDILEMSQASDFGVSMLDQDVSLNEGPQLPL---DISALVGP 110
            ..:.:.|:....|::  |.::...|.|......:...|:    |.|::.|:..:   :...|..|
  Fly   138 PVQNENSYTYRGLSESPVENKSIGDTLRKPPQKERKTSI----VWLSDSPEKKVTQNERKILDSP 198

  Fly   111 QSSGNLEEIPQSVEGSFSNLIDLPNRQVLTNLVNRDENHVIRKFEAVEELPINQNAWGLNVSKKP 175
            ....:.|:.|....|:..:|:.||:                                       .
  Fly   199 LQRFSFEDFPNKENGNRHHLLTLPD---------------------------------------S 224

  Fly   176 PAPPQPVE--------------ASKSAPGHGKQPKAGASLKPSL------------SAKLFQSS- 213
            |.|||||:              ..|.:|.:.......||:...|            |..||:.| 
  Fly   225 PPPPQPVKKPEKTMWQNETKTIQDKDSPANPLVSNNLASISTLLDSSRAPNTYKGSSRNLFEDSP 289

  Fly   214 -----------RGFAKRN--PRKPLSRCVSSSSSTTSLSSVPTDHHEELLDFETILIRKAQEYKE 265
                       .|.||.|  |.||.:..:..:|.|:|.|..........:.|:..|   |...|:
  Fly   290 EKSGSGEQGYKLGSAKENEIPTKPATASLERNSVTSSPSPAAPLKPRYSVAFDNSL---ADYLKD 351

  Fly   266 KQQAIANNPMLASEHSKESIKTLVDDGWLRRNT------KENTLDEEVPFAEANNNSGTSK---- 320
                :|.|...:.:.:|::.:||.......|||      |..:|.:::|....|..:|...    
  Fly   352 ----LAQNDNFSIDPNKQNTETLKSTLGFFRNTYVELMEKYCSLIDQIPAMHFNEIAGFQPNTFL 412

  Fly   321 ---------KTNFGLANLDLSKLKPTVK-EEKVLQAKPDQMAIIQELQTDMNSSMNQKPDHLNHT 375
                     |....|....|.|.:..:| |::.|:.:..:|...|..||.::||..:|...:...
  Fly   413 KLKVMRQKFKARTQLVQNSLDKKESQLKAEQEALEKEEIEMQAEQAQQTVLSSSSPEKSRPIMPL 477

  Fly   376 PPASSQKSV--------------APKNKPPPSEQETDSDSDSVVAESEEEQEPQEYRQLSKRRKI 426
            |.....|..              .|.|..|||                   .|::.:.:.||:::
  Fly   478 PKVQEIKDEKIPNRNQLIHDLCGEPDNFSPPS-------------------SPRDTQLIPKRQQL 523

  Fly   427 VSTASGKVEVAAPVEIPNKVEPETETFAQENPDFSADEDQDATYVPENKKKDKAKRKQAAGKQKT 491
            ::...|              ||:         |||          |.:|:.|             
  Fly   524 INDLCG--------------EPD---------DFS----------PPSKQND------------- 542

  Fly   492 TKPKAEPKPKTEKKAKVKAEKKPKAEKKPRNSKKAIAVEPAPDPEEDERQPLNPEDLKYVLALEA 556
                                        |...:|.                   |:|.:.|..|.
  Fly   543 ----------------------------PHLLRKC-------------------EELVHDLCEEP 560

  Fly   557 GDITSVPRINVQDLEEADATAQRYIRTFAAGPNPGLSEGSNIRVDEKRAAARKKLEERIAAGKLN 621
            .|..:...:...||||....          ||..|.:...   :|:         :|....|.|.
  Fly   561 DDYLAQSMMLDGDLEEEQLN----------GPTQGTTTSG---MDD---------DEDDLEGLLA 603

  Fly   622 ENFVTINIQKKKFVRGKKSVNFSKYK-----KQQWRHKKRVAALSGPDMDMGGCDGGVLTCFQCG 681
            |    |..:.:|....:...|...||     |.:.:||:                          
  Fly   604 E----IEDEHQKMQGRRSEFNGYSYKELEAVKVKEKHKE-------------------------- 638

  Fly   682 GVGHFAQQCKVKGDSLLPLSAQLEEDPSPFPTLAEA--QEMASQGAVVAHSRNISRLPQAANAAI 744
                            .|::..|::|  .||...||  ::|.||.|  |:...:|....:.:.::
  Fly   639 ----------------TPINISLDDD--GFPEYDEAMFEQMHSQAA--ANKSRVSSAGPSTSKSV 683

  Fly   745 LQGDELNESEEDDQESSGDEEVQQHPDPNWSSDEMDVDFEALDAAVEASLSQPVSQEKAASPIKT 809
            :...:  .|....|:.||:.....|      :|.:..:|:                         
  Fly   684 VPTKQ--TSALHSQKLSGNFHANVH------NDGITGEFD------------------------- 715

  Fly   810 YVGHKIPEEFLKQAGLDTTASSSNRSQHGGVKPLYDLLPDGSVQDTTPEVLEALHMFGHTNFRKG 874
              |.|.              ..|.|..||                       ..:.||..:||..
  Fly   716 --GQKF--------------EHSTRLMHG-----------------------LSYSFGLKSFRPN 741

  Fly   875 QDRAIMRTLSGLSSLVTLSTGSGKSLCYQLPAYLYSRKVGAITLVISPLVSLMEDQVTGVPHF-L 938
            |.:.|..||.|....|.:.||.||||||||||.|    ...:|:|||||.||:.||:..:... :
  Fly   742 QLQVINATLLGNDCFVLMPTGGGKSLCYQLPAIL----TEGVTIVISPLKSLIFDQINKLASLDI 802

  Fly   939 RAHCLHTNQTAPQRMKIQQMIANGE--IDILLVSPEAVVAGERATGFGAILRQLPPIAFACIDEA 1001
            .|..|...|.....|.|.:.:.:..  :.:|.|:||.:.:..|.......|.....|:...||||
  Fly   803 CAKSLSGEQKMADVMAIYRDLESQPPMVKLLYVTPEKISSSARFQDTLDTLNSNNYISRFVIDEA 867

  Fly  1002 HCVSQWSHNFRPSYLMICKVLRKNLGVRTVLGLTATATLPTRVSIINHLG-------ISDGERGI 1059
            ||||||.|:|||.|..: .||:|.......:.||||||...|:.|:..|.       :|...|..
  Fly   868 HCVSQWGHDFRPDYKKL-GVLKKRFPNVPTIALTATATPRVRLDILAQLNLKNCKWFLSSFNRSN 931

  Fly  1060 ISDIPLPDNLVLSVSKDENRDAALLQLLNSERFEPCQ-SIIIYCTRRDECERIAGFIRTCVQDRR 1123
            :....||...| |...|.:|..         |.:|.. |.||||..|.||:              
  Fly   932 LRYRVLPKKGV-STLDDISRYI---------RSKPQHFSGIIYCLSRKECD-------------- 972

  Fly  1124 EPTQDQTKKRKRVNWQAEPYHAGMPASRRRTVQKAFMSNELRIVVATIAFGMGINKPDIRAVIHY 1188
                :.:||..:...:|..||||:..:.|.:.||.:::.::|::.||:||||||:|||:|.|:||
  Fly   973 ----ETSKKMCKDGVRAVSYHAGLTDTDRESRQKDWLTGKMRVICATVAFGMGIDKPDVRFVLHY 1033

  Fly  1189 NMPRNFESYVQEIGRAGRDGLPSHCHLFLDAKGGDQSELRRHVYSNSIDRHVIRKL-LQKIF-VP 1251
            ::|::.|.|.||.|||||||..:.|.|:.:.  .|...:::.:.|:...::.::|: :..:: :.
  Fly  1034 SLPKSIEGYYQEAGRAGRDGDVADCILYYNY--SDMLRIKKMLDSDKALQYNVKKIHVDNLYRIV 1096

  Fly  1252 CSCDKEASKRTALPIPLEGDGPRVHMCPGHEIGFSVEKTVEMLDIPAENISTLLCYMELDPRWCI 1316
            ..|:.....|.|..:...|:         |   |:.|:.:|..:...:|......|..:|.    
  Fly  1097 GYCENLTDCRRAQQLDYFGE---------H---FTSEQCLENRETACDNCINKRAYKAVDA---- 1145

  Fly  1317 SVLSSAYVMAKVISYGGPKYLKHAAKECPPLAMAIALQIRDKTFKEDSNIIEFSVTDIAAGIGWN 1381
                                |:||.|...                        :|.|:.:|    
  Fly  1146 --------------------LEHARKAAR------------------------AVKDLCSG---- 1162

  Fly  1382 SGVVKYQLKDLEWVKVNGYPKRSPIT-VSFYDL--GFRIKVPGDFTESEIDNALDTLYTRSVKQE 1443
                                 ||..| :...|:  |.:||...||...:..:             
  Fly  1163 ---------------------RSRFTLLHIADVLKGSKIKKIIDFNHHKTPH------------- 1193

  Fly  1444 RTQLIQLQYVAHGLAAVAYSSCGQCCNADFPQDRGEQL--KAIVRNY------FANDYPQDLELE 1500
                       ||:.            .|:.::...:|  |.::..:      |.||:||..   
  Fly  1194 -----------HGVL------------KDWDKNDVHRLLRKMVIDGFLREDLIFTNDFPQAY--- 1232

  Fly  1501 IEPSNVPDENIIDDVHALINMYPDNTFTGRNIARIFHGIMSPNYPAVIWGRCKFWRAHV 1559
                                     .:.|.||:::..|  :||:...:....|..:|.|
  Fly  1233 -------------------------LYLGNNISKLMEG--TPNFEFAVTKNAKEAKAAV 1264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 130/365 (36%)
DEAD 872..1039 CDD:278688 65/170 (38%)
HELICc 1073..1216 CDD:238034 52/144 (36%)
BlmNP_524319.2 RecQ 729..1359 CDD:223588 179/723 (25%)
DEAD 739..908 CDD:278688 66/174 (38%)
HELICc 931..1061 CDD:238034 56/158 (35%)
RecQ_Zn_bind 1066..1134 CDD:292742 12/80 (15%)
RQC 1140..1253 CDD:286470 34/252 (13%)
HRDC 1286..1352 CDD:278967
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96127098
eggNOG 1 0.900 E1_COG0514
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13710
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.