DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and CG14443

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_572330.2 Gene:CG14443 FlyBaseID:FBgn0029880 Length:736 Species:Drosophila melanogaster

Alignment Length:837 Identity:162/838 (19%)
Similarity:255/838 (30%) Gaps:319/838 (38%)


  Fly   613 ERIAAGKLNENFVTI-NIQKKKFVRGKK----------------------SVNFSKY-------- 646
            :::..|...:|.... .:|||.|::|.|                      ||..||:        
  Fly     6 KKLVIGNWKDNETDAEKVQKKPFLKGTKSSIWGSSASDISGQSRSLKSSSSVLSSKFVTKRLFTI 70

  Fly   647 ----KKQQWRHKKRVAALSGPDMDMGGCDGGVLTCFQCGGVGHFAQQCKVKGDSLLPLSAQLEED 707
                :.|:...|.|..:.|||              ...||.....::.:.|..|:          
  Fly    71 QHGIEGQKPNFKIRSESFSGP--------------HSAGGFSKSTRESRSKSRSM---------- 111

  Fly   708 PSPFPTLAEAQEMASQGAVVAHSRNISRLPQAANAAILQGDELNESEEDDQESSGDE-------- 764
                          ..|..    |..|.|..::.:|...|.|.:.|:.:...||..:        
  Fly   112 --------------GNGKF----RGKSHLRSSSESAHSSGSESSSSDSNSGSSSDSDSTTGSSSH 158

  Fly   765 --EVQQHP---------DPNWSSDEMDVDFEALDAAVEASLSQPVSQ---EKAASPIKTY----- 810
              :..:.|         ...|.|..   .|:|:..:.|...|:..|.   :|...|.||.     
  Fly   159 GSDTGERPRMRSAVFRIHETWQSPN---SFKAVKTSRENKESRSRSSSLPQKRFCPSKTQNDLTY 220

  Fly   811 -----------------VGHKIPEEFLKQAGLDTTASS-----------SNRSQHGGVKPLYDLL 847
                             ||.:.|  :.|......:.||           .:||.|.......|..
  Fly   221 GSPEPKSPSNRGRNSWRVGMRTP--WKKSQSRSMSCSSIQKILVSRSFTRSRSPHRNTLCYQDQS 283

  Fly   848 PD---GSVQDTTPEVLEALHMFGHTNFRKGQDRAI----MRTL---------SGLS--------- 887
            .:   .|..:|..:.::.::. ...|:||..:..:    ||.|         ||.:         
  Fly   284 KNPSRPSNYNTWKQPMDEVYN-NAANYRKRHNITLTSWNMRNLPEPVLSFERSGFNATILQQLED 347

  Fly   888 ---------------------SLVTLS-TGSGKSLCYQLPAY--------LYSRKVGAITLVISP 922
                                 ::|.:| .|:||:|.|.||..        |...|.|.|.|:   
  Fly   348 QGYDGPTPIQAQTWSIAKEGKNIVMISGKGTGKTLGYLLPGIMKMHNQRGLMQHKKGPIVLI--- 409

  Fly   923 LVSLMEDQV---------TGVPHFLRAHCLHTNQTAPQRMKIQQMIANGEIDILLVS-------- 970
            ||...|..|         |. |..||.|||..|         .|...:.|.|:|:.|        
  Fly   410 LVDCREAAVMVQREVLYYTN-PLELRTHCLLGN---------SQWQGHAECDLLVASAGRLLQMI 464

  Fly   971 --PEAVVAGERATGF--------------GAILR---QLPPIAFACIDEAHCVSQWSHNFRPSYL 1016
              .:.||..||.|..              |.|.|   :|.|.|...:..    :.||.|.:    
  Fly   465 DNKKHVVELERCTYLVLDNIDRMIDVGLEGNICRLLCRLRPHAQLIVSS----TSWSSNLK---- 521

  Fly  1017 MICKVLRKNLGVRTVLGLTATATLPTRVSIINHLGISDGERGIISDIPLPDNLVLSVSKDENRDA 1081
               ::..|.||..|.:          ||..||::|:.      :.:|.....:|..:||.|....
  Fly   522 ---RMANKFLGQYTAI----------RVGEINNIGVR------LQNIRQRVEVVNGLSKVERLMK 567

  Fly  1082 ALLQLLNSERFEPCQSIIIYCTRRDECERIAGFIRTCVQDRREPTQDQTKKRKRVNWQAEPYHAG 1146
            .|..:.::....  ..::||..|:...|.:...||.||                   ..|..|.|
  Fly   568 ELTAIYDTSDIP--GKVVIYVKRQKVVEELVDLIRNCV-------------------PCEGIHGG 611

  Fly  1147 MPASRRRTVQKAFMSNELRIVVATIAFGMGINKPDIRAVIHYNMPRNFESYVQEIGRAGRDGLPS 1211
            ..|...:.:...|.:....|:|||......::.|.||.||:|:.|.|.:.|||.:.|.|......
  Fly   612 RTAQENQGIIHDFGTGAYNIIVATQMTSNCLDVPGIRYVINYDFPDNIDKYVQRMSRTGCLSYNR 676

  Fly  1212 HCHL-----------------FLDAKGGDQSELRRHVYSNSIDRHVIRKLLQKIFVP 1251
            :|.:                 ||            .:....|..|:::...:|:|.|
  Fly   677 NCEVISFFTMANYKLVTEVVDFL------------KICKQEIGPHLLQLAEEKMFGP 721

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 101/459 (22%)
DEAD 872..1039 CDD:278688 56/255 (22%)
HELICc 1073..1216 CDD:238034 35/160 (22%)
CG14443NP_572330.2 P-loop_NTPase 332..535 CDD:304359 51/237 (22%)
DEXDc 345..544 CDD:214692 54/233 (23%)
Helicase_C 560..670 CDD:278689 33/131 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4803
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.