DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and Recql

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:XP_006237679.1 Gene:Recql RGDID:1311071 Length:645 Species:Rattus norvegicus

Alignment Length:474 Identity:141/475 (30%)
Similarity:217/475 (46%) Gaps:110/475 (23%)


  Fly   841 KPLYDLLPDGSVQ-----DTTP------------EVLEALH-MFGHTNFRKGQDRAIMRTLSGLS 887
            |.:...|.|.:.:     ||:|            :|...|. :|....||..|...:..|::...
  Rat    44 KRIKQCLEDSAAEASGDCDTSPAAWSKEDFPWSGKVKHVLRDVFKLQKFRPLQLETVNATMARKD 108

  Fly   888 SLVTLSTGSGKSLCYQLPAYLYSRKVGAITLVISPLVSLMEDQV-----TGVPHFL------RAH 941
            ..:.:.||.||||||||||....    ..||||.||:||||||:     .|:...:      :.|
  Rat   109 IFLVMPTGGGKSLCYQLPALCSD----GFTLVICPLISLMEDQLMVLQQLGISATMLNSSSSKEH 169

  Fly   942 --CLHTNQTAPQRMKIQQMIANGEIDILLVSPEAVVAG-------ERATGFGAILRQLPPIAFAC 997
              |:||          :.|..|..:.::.|:||.:...       |:|...|    :|..:|   
  Rat   170 VKCVHT----------EMMNKNSHLKLIYVTPEKIAKSKMFMSRLEKAYEAG----RLTGVA--- 217

  Fly   998 IDEAHCVSQWSHNFRPSYLMICKVLRKNLGVRTVLGLTATATLPTRVSIINHLGISDGERGIISD 1062
            :||.||.|||.|:|||.|..: .:|::.....:::|||||||        ||: :.|.::.:..:
  Rat   218 VDEVHCCSQWGHDFRPDYKAL-GILKRQFPNISLIGLTATAT--------NHV-LKDAQKILCVE 272

  Fly  1063 IPLP-------DNLVLSV----SKDENRDAALLQLLNSERFEPCQSIIIYCTRRDECERIAGFIR 1116
            ..|.       .||...|    |..|:....:..|:|. |::. :|.||||..:.:.|::     
  Rat   273 KCLTFTASFNRPNLYYEVRQKPSSAEDFIENIANLING-RYKG-KSGIIYCFSQKDSEQV----- 330

  Fly  1117 TCVQDRREPTQDQTKKRKRVNWQAEPYHAGMPASRRRTVQKAFMSNELRIVVATIAFGMGINKPD 1181
                         |...:::..:|..|||.|....|..|...:.:|||::||||:||||||:|||
  Rat   331 -------------TISLQKLGVRAGTYHANMEPEDRTKVHTQWSANELQVVVATVAFGMGIDKPD 382

  Fly  1182 IRAVIHYNMPRNFESYVQEIGRAGRDGLPSHCHLFLDAKGGDQSELRRHVYSNSIDRHVIRKLLQ 1246
            :|.|||::|.::.|:|.||.||||||...:.|.|:...  ||...:...|...::.:       |
  Rat   383 VRFVIHHSMSKSMENYYQESGRAGRDDWRADCILYYGF--GDIFRISSMVVMENVGQ-------Q 438

  Fly  1247 KIFVPCS-CDKEASKRTAL 1264
            |::...| |...:..|.||
  Rat   439 KLYEMVSYCQNISKCRRAL 457

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 123/386 (32%)
DEAD 872..1039 CDD:278688 61/187 (33%)
HELICc 1073..1216 CDD:238034 53/147 (36%)
RecqlXP_006237679.1 recQ_fam 82..543 CDD:129701 134/437 (31%)
DEAD 93..258 CDD:278688 61/187 (33%)
HELICc 285..417 CDD:238034 55/152 (36%)
RecQ_Zn_bind 422..478 CDD:292742 9/44 (20%)
RQC 484..582 CDD:298958
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.