DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and Blm

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:XP_006223421.1 Gene:Blm RGDID:1308810 Length:1411 Species:Rattus norvegicus

Alignment Length:1480 Identity:348/1481 (23%)
Similarity:532/1481 (36%) Gaps:441/1481 (30%)


  Fly   139 LTNLVNRDENHVIRKFEAVEELPINQNAWGLNVSKKPPA-------PPQ--------PVEASKSA 188
            |.||..:.:.|..||.:       ||    .:|||..|:       .|:        ||.:.|..
  Rat    15 LNNLQEQLQRHSARKLK-------NQ----FSVSKPKPSGFTFKKKTPEGDVSVVRTPVLSDKDV 68

  Fly   189 PGHGKQPKAGASLKPSLSAKLFQSS-RGFAKRNPRKPLSRCVSSSSSTTSLSSVPTDHHEELLDF 252
                ...:|.:..:|.|.....||: .||.|.:|....|:...|..|...:..:|.|        
  Rat    69 ----NMSEALSYTEPPLHKPKQQSNIDGFFKNSPGGQQSKETCSELSLPEVVQIPQD-------- 121

  Fly   253 ETILIRKAQEYKEKQQAIANNPMLASEHSKESIKTLVDDGWLRRNTKENTLDE-EVP----FAEA 312
            .:....|....|:...||...  |....|.:|:....|            :|: :||    |...
  Rat   122 ASCTTPKTPAVKKPHVAIFKK--LEFSSSADSLSDWAD------------IDDFDVPASDAFVSL 172

  Fly   313 NNNSGTSKKTNFGLANLDLSKLKPTVKEEKVLQAKPDQMAIIQE-LQTDMNSSMNQKPDHLNH-- 374
            ..|..|...|...|::...:..||..:...|   |.|......| ||.|:.....::.|.|:.  
  Rat   173 TRNPTTRVSTAKKLSSSKRNFFKPPPRASAV---KADLTPSSPECLQVDLTKEQEEEADCLSRDV 234

  Fly   375 ----TPPASSQKSVAPKNKPPPSEQETDSDSDSVVAESEEEQEPQEYRQLSKR----RKIVSTAS 431
                |.|||                           |...|::.||...|..|    |.|.|...
  Rat   235 ICIDTDPAS---------------------------EELLEKDVQEGLSLDARLGTERGIDSAKK 272

  Fly   432 GKVEVAAPVEIPNKVEPETETFAQENPDFSADEDQDATYVPENKKKDKAKRKQAAGKQKTTKPKA 496
            ...:.||      ...|:...:.:.|     |.|.|..:||                        
  Rat   273 SHEDEAA------FQSPQNALYFEHN-----DNDYDIDFVP------------------------ 302

  Fly   497 EPKPKTEKKAKVKAEKKPKAEKKPRNSKKAIAVEPAPDPEEDERQPLN-------PEDLKYVLAL 554
             |.|:             :......:|.|..::....|..:.|:..|:       ||::      
  Rat   303 -PSPE-------------EIISTASSSLKCSSMLKDLDDSDKEKDILSTSKDLSKPEEM------ 347

  Fly   555 EAGDITSVPRINVQDLEEADA----TAQRYIRTFAAGPNPGLSEG-----SNIRVDEKRA--AAR 608
                  :.|:.::...|:.||    ..|:.||         :.|.     ..:.:||.:|  ...
  Rat   348 ------TTPKSDLGTNEDCDAQQTSLQQQLIR---------VMEHICKLVDTVPIDELKALTCGD 397

  Fly   609 KKLEERIAAGKLNENFVTINIQKKKFVRGKKSVNFSKYKKQQWRHKKRVAALSGPD-MDMGGCDG 672
            |.|::|             :|::|.......:.|........|||:        || :|      
  Rat   398 KLLQQR-------------DIRRKLLAEAGFNRNDVNLLGSLWRHR--------PDSLD------ 435

  Fly   673 GVLTCFQCGGVGH--------FAQQCKVKGDSLLPLSAQLEEDPSPFP-TLAEAQEMASQGAVVA 728
            ..:.|..| .|||        :.....:..:..||.:|..:...|..| :|:|...:.|......
  Rat   436 NTVQCDSC-PVGHPGKELNSPYLPSHSLSTEECLPTTASGKTGFSATPKSLSERPPLNSHLQKSF 499

  Fly   729 HSRNISRLPQA---ANAAILQGDELNES---EEDDQESSG---DEEVQQHPD-PNWSSDEMDVD- 782
            .|.|.:..|:.   ..:....|..|..:   :|....:||   :.|||...| .|::.|:.|.| 
  Rat   500 VSSNWAETPRTESRTESTYFPGSVLTSTTVKDESKHVASGRDIEREVQASYDIDNFNIDDFDDDD 564

  Fly   783 ----------FEALDAAVEA-----------SLSQPVSQEKAA-SPIKTYVGHKIPEEFLKQAGL 825
                      |....::..|           |||:.:|..||. .|:.:...:|...|.::... 
  Rat   565 DDDWENIMHNFSVSKSSTAAYPPIKEGGPVKSLSERISSAKAKFLPVASTAQNKNLSESIQNCS- 628

  Fly   826 DTTAS--SSNRSQHGGVKPLYDLLPDGSVQDTTPEVLEALHM----FGHTNFRKGQDRAIMRTLS 884
            |..|.  ||...:|...:.|           ..|...|.:.:    ||..|||..|..||...|.
  Rat   629 DKFAQNLSSKNPKHEHFQSL-----------NFPHTKEMMKIFRKKFGLHNFRTNQLEAINAALL 682

  Fly   885 GLSSLVTLSTGSGKSLCYQLPAYLYSRKVGAITLVISPLVSLMEDQVTGVPHF-LRAHCLHTNQT 948
            |....:.:.||.||||||||||.:..    .:|:|||||.||:.|||..:..| :.|..|..::|
  Rat   683 GEDCFILMPTGGGKSLCYQLPACVSP----GVTIVISPLRSLIVDQVQKLTSFDIPATYLTGDKT 743

  Fly   949 APQRMKIQQMIANGE--IDILLVSPEAVVAGERATGFGAILRQLPPIAFACIDEAHCVSQWSHNF 1011
            ..:...|...::..:  |.:|.|:||.|.|..|.......|.:...:|...||||||||||.|:|
  Rat   744 DSEAANIYLQLSKKDPIIKLLYVTPEKVCASNRLISTLENLYERKLLARFVIDEAHCVSQWGHDF 808

  Fly  1012 RPSYLMICKVLRKNLGVRTVLGLTATATLPTRVSIINHLGISDGERGIISDIPLPDNLVLSVSKD 1076
            |..|..: .:||:......|:.|||||....:..|:..|.|...:  :.|......||...|...
  Rat   809 RQDYKRM-NMLRQRFPSVPVMALTATANPRVQKDILTQLKILRPQ--VFSMSFNRHNLKYYVLPK 870

  Fly  1077 ENRDAALLQLLNSERFEPCQSIIIYCTRRDECERIAGFIRTCVQDRREPTQDQTKKRKRVNWQAE 1141
            :.:..||..|....:..|..|.||||..|.||:.:|..:                  :|....|.
  Rat   871 KPKKVALDCLEWIRKHHPYDSGIIYCLSRKECDTMADTL------------------QREGLAAL 917

  Fly  1142 PYHAGMPASRRRTVQKAFMSNE-LRIVVATIAFGMGINKPDIRAVIHYNMPRNFESYVQEIGRAG 1205
            .||||:..|.|..||..:::.: .:::.|||||||||:|||:|.|:|.::|::.|.|.||.||||
  Rat   918 AYHAGLSDSARDEVQHKWINQDNCQVICATIAFGMGIDKPDVRFVVHASLPKSVEGYYQESGRAG 982

  Fly  1206 RDGLPSHCHLF-------------LDAKGGDQSELRRHV--------YSNSIDRHVIRKLL---- 1245
            |||..|||.||             :..|.|:......||        |..:|......:||    
  Rat   983 RDGEISHCVLFYTYHDVTRLKRLIMMEKDGNYHTRETHVNNLYSMVHYCENITECRRIQLLAYFG 1047

  Fly  1246 QKIFVPCSCDKEASKRTALPIPLEGDGPRV---HMCPGHEIGFSVEKTVEMLDIPAENISTLLCY 1307
            :|.|.|..|.|.               |.|   :.|...:.     ||.::.| ..:||...:..
  Rat  1048 EKGFNPDFCKKH---------------PDVSCDNCCKTKDY-----KTKDVTD-DVKNIVRFVQE 1091

  Fly  1308 MELDP---------RWCISVLSSAYV---MAKVIS--YG-GPKYLKHAAKECPPLAMAIALQIRD 1357
            ....|         |:.:::|...::   .|||.|  :| |..|.:|.|               :
  Rat  1092 HSSSPGTRNIGPAGRFTLNMLVDIFLGSKSAKVQSGIFGKGSAYSRHNA---------------E 1141

  Fly  1358 KTFKEDSNIIEFSVTDIAAGIGWNSGVVKYQLKDLEWVKVNGYPKRSPITVSFYDLGFR------ 1416
            :.||:   :|...:.|                :|| ::..|..|      :::..||.:      
  Rat  1142 RLFKK---LILDKILD----------------EDL-YINANDQP------IAYVMLGTKAHSVLS 1180

  Fly  1417 --IKVPGDFTESEIDNALDTLYTRSVKQERTQLIQLQYVAHGLAAVAYSS 1464
              :||  ||.|:|        .:.|||:::             ||||:.|
  Rat  1181 GHLKV--DFMETE--------NSSSVKKQK-------------AAVAHVS 1207

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 132/375 (35%)
DEAD 872..1039 CDD:278688 66/170 (39%)
HELICc 1073..1216 CDD:238034 55/144 (38%)
BlmXP_006223421.1 BLM_N 10..365 CDD:292819 92/478 (19%)
BDHCT 371..408 CDD:285334 10/59 (17%)
BDHCT_assoc 424..648 CDD:292821 51/240 (21%)
recQ_fam 658..1141 CDD:129701 165/544 (30%)
DEAD 670..842 CDD:278688 66/177 (37%)
HELICc 862..993 CDD:238034 57/149 (38%)
RecQ_Zn_bind 998..1067 CDD:292742 15/84 (18%)
RQC 1077..1179 CDD:214936 25/144 (17%)
HRDC 1210..1290 CDD:128635
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.