DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and Wrn

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:XP_006222319.1 Gene:Wrn RGDID:1564788 Length:1400 Species:Rattus norvegicus

Alignment Length:1238 Identity:295/1239 (24%)
Similarity:480/1239 (39%) Gaps:336/1239 (27%)


  Fly   254 TILIRKAQEYKEKQQAIANNPMLASEHSKESIKTLVDDGWLRRNTKENTLDEEVPFA-------- 310
            |.|.||..|:...|     |...|:: .|.||             :::.|::::||.        
  Rat     4 TSLRRKFPEWMSTQ-----NKSCATQ-EKASI-------------QKSVLEDDLPFLEFTGSVVY 49

  Fly   311 --EANNNSGTSKKTNFGLANLDL----SKLKPTVKEEKVLQAKPDQMAIIQELQTDMNSSMNQKP 369
              ||::.|..|:..:..|::.|:    .:..|..|     |.|..::|:||       ..:::..
  Rat    50 SYEASDCSFLSEDISMHLSDGDVVGFDMEWPPIYK-----QGKRSRVAVIQ-------LCVSESK 102

  Fly   370 DHLNHTPPASSQKSVAPKNKPPPSEQETDSDSDSVVAESEEEQEPQEYR-QLSKRRKIVSTASGK 433
            .:|.|.    |..||.|:......|.::...: .|..|.::.:..:::. :|....::...|:.|
  Rat   103 CYLFHI----SSMSVFPQGLKMLLENKSIRKA-GVGIEGDQWKLLRDFDVKLESFVELTDVANRK 162

  Fly   434 VEVAAPVEIPNKVEP-------ETETFAQEN-PDFSADEDQD--------ATYVPENKKKDKAKR 482
            ::.|....:...|:.       :.::....| .||...|||.        |..:...|.::....
  Rat   163 LKCAETWSLNGLVKHVLGKQLLKDKSIRCSNWSDFPLSEDQKLYAATDAYAGLIIYQKLENLGDA 227

  Fly   483 KQAAGKQKTTKPKAEPKPKTEKKAKVKAEKKPKAEKKPRNSKKAIAVEPAPDPEEDERQPLN--P 545
            .|.....     |||             |..|...||..||           ..|:.|...|  |
  Rat   228 VQVFALN-----KAE-------------ESLPMEMKKQLNS-----------ISEEMRDLANHFP 263

  Fly   546 EDLKYVLALEAGDITSVPRINVQDLEEADATAQRYIRTFAAGPNPGL----SEGSNIRVDEKRAA 606
            ...:.:..|:     .||.| ::::.|...:.::.|   .|..:.|.    ..||::...|..||
  Rat   264 VTCRNLETLQ-----RVPMI-LENISENLCSLRKVI---CASTDTGTKLEPGGGSHLLSSEGSAA 319

  Fly   607 ARKKLEERIAAGKLNENFVTINIQKKKFVRGKKSVNFSKYKKQQWRHKKRVAALSGPDMDMGGCD 671
            ..:| |:::...:                      .|.|.|::.|          .|::|     
  Rat   320 VGEK-EKQMGEHR----------------------TFPKIKEEAW----------DPELD----- 346

  Fly   672 GGVLTCFQCGGVGHFAQQCK-VKG-------DSLLPLSAQLEEDPSPFPTLAE--AQEMASQGAV 726
                :..:...|..|.:|.| .||       ||||   .::.|.....|:::|  .|::..|...
  Rat   347 ----SLVKHEAVDVFRKQVKQEKGGFEDEMEDSLL---REVMERTCLMPSISEYDLQDLEQQAKE 404

  Fly   727 VAHSRNISRLPQAANAAILQGDELNESEEDDQESSGDEEVQQHPDPNWSSDEMDVDFEALDAAVE 791
            ..|           ||...|..|....::|:::||...|          ||| |::.|.|.:.  
  Rat   405 EKH-----------NAISHQFSEHLSPDDDEKDSSYIIE----------SDE-DLEMEMLKSL-- 445

  Fly   792 ASLSQPVSQEKAASPIKTYVGHKIPEEFLKQAGLDTTASSSNRSQHGGVKPLYDLLPDGSVQDTT 856
            .:|:..|.:...:..::|.....:|.|.....|.:..........|        |||:.:.:.  
  Rat   446 ENLNSDVGEPTHSKWLETGGSVNLPPEEEDGDGKEAFEEEQEEEDH--------LLPEPNAKQ-- 500

  Fly   857 PEVLEALH-MFGHTNFRKGQDRAIMRTL-SGLSSLVTLSTGSGKSLCYQLPAYLYSRKVGAITLV 919
               :..|. .|||.:|:..|.:.|...| ....::|.::||.|||||:|.|. :|:.|:|   :|
  Rat   501 ---INCLKTYFGHCSFKPVQWKVIHSVLEERRDNVVVMATGYGKSLCFQYPP-VYTGKIG---IV 558

  Fly   920 ISPLVSLMEDQV-----TGVPHFLRAHCLHTNQTAPQRMKIQQMIANGEIDILLVSPEAVVAGER 979
            ||||:|||||||     :.:|..|..        :.|...|...|..|...|:.::||.      
  Rat   559 ISPLISLMEDQVLQLEMSNIPACLLG--------SAQPKNILGDIKLGRYRIIYITPEF------ 609

  Fly   980 ATGFGAILRQLPP---IAFACIDEAHCVSQWSHNFRPSYLMICKVLRKNLGVRTVLGLTATATLP 1041
            .:|...:|:||..   |....:|||||:|:|.|:||.|:..:.. |:..|.:..|:.|:|||:..
  Rat   610 CSGNLDLLQQLDSNIGITLIAVDEAHCISEWGHDFRSSFRTLGS-LKTALPLVPVIALSATASSS 673

  Fly  1042 TRVSIINHLGISDGE---RGIISDIPLPDNLVLSVSKDENRDAALLQLL-------NSERFEPCQ 1096
            .|..||..|.:.|..   .|.  |.|   ||.|.|   |.:...:||.|       .|..:|...
  Rat   674 IREDIIRCLNLKDPHITCTGF--DRP---NLYLEV---ERKTGNILQDLKPFLVRKTSSAWEFEG 730

  Fly  1097 SIIIYCTRRDECERIAGFIRTCVQDRREPTQDQTKKRKRVNWQAEPYHAGMPASRRRTVQKAFMS 1161
            ..||||..|...|::                  |.:..::|...:.|||||..|.|:.:...|:.
  Rat   731 PTIIYCPSRKVTEQV------------------TVELGKLNVACQAYHAGMKISERKDIHHRFLR 777

  Fly  1162 NELRIVVATIAFGMGINKPDIRAVIHYNMPRNFESYVQEIGRAGRDGLPSHCHLFLDAKGGDQSE 1226
            :|::.|||||||||||||.|||.||||..|:..|||.|||||||||||.|.||| |.|.....:.
  Rat   778 DEIQCVVATIAFGMGINKADIRKVIHYGAPKEMESYYQEIGRAGRDGLQSSCHL-LWAPADFNTT 841

  Fly  1227 LRR--HVYSNSIDRHVIRKL--LQKIFVPCSC----------DKEASKRTALPIPLE----GDGP 1273
            ..|  .:::.....|.::.:  ::|......|          ||...|.:...:..|    ...|
  Rat   842 RNRLIEIHNEKFRLHKLKMMVKMEKYLHSSRCRRQIILSHFEDKRLQKASLAVMGTEKCCDNCRP 906

  Fly  1274 RVHMC--------PGHEIG---FSVEKTVEMLD------IP------------------------ 1297
            |::.|        ...:.|   |.:...|::|.      ||                        
  Rat   907 RLNHCSSANNSEDTAQDFGPQAFQLLSAVDILQEKFGIKIPILFLRGSNSQRLPEKYHNHRLFGA 971

  Fly  1298 ----AENISTLLCYMELDPRWCISV-LSSAYVMAKVISYGGPKYLKHAAKECPPLAMAIALQIRD 1357
                ||:....|.:..:...:.:.| ..:.::....::..|.|:|..|..:.||   ::.||..:
  Rat   972 GKEQAESWWKALSHHLIAEGFLVEVPKQNKFIKTCSLTKKGRKWLGEAILQSPP---SLVLQADE 1033

  Fly  1358 KTF 1360
            :.|
  Rat  1034 EAF 1036

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 139/374 (37%)
DEAD 872..1039 CDD:278688 60/176 (34%)
HELICc 1073..1216 CDD:238034 63/150 (42%)
WrnXP_006222319.1 RNaseD_like 55..223 CDD:176650 33/185 (18%)
recQ_fam 502..975 CDD:129701 158/519 (30%)
DEAD 515..676 CDD:278688 61/180 (34%)
HELICc <730..832 CDD:238034 56/121 (46%)
RecQ_Zn_bind 837..904 CDD:292742 8/67 (12%)
RQC 923..1016 CDD:214936 12/93 (13%)
HRDC 1118..1194 CDD:128635
HTH_40 1226..1316 CDD:291179
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.