DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and Recql5

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_001099323.1 Gene:Recql5 RGDID:1310823 Length:973 Species:Rattus norvegicus

Alignment Length:415 Identity:136/416 (33%)
Similarity:207/416 (50%) Gaps:85/416 (20%)


  Fly   865 MFGHTNFRKG-QDRAIMRTLSGLSSL-VTLSTGSGKSLCYQLPAYLYSRKVGAITLVISPLVSLM 927
            :||..:|:.. |:.|||..:.|...: |.:.||:||||||||||.|    ...||:|:|||::|:
  Rat    23 VFGFDSFKTPLQESAIMAVVKGDKDVFVCMPTGAGKSLCYQLPAVL----AKGITIVVSPLIALI 83

  Fly   928 EDQVTGVPHFL----RAHCLHTNQTAPQRMKIQQMIANGEID-----ILLVSPE-AVVAGERATG 982
            :||   |.|.|    :...|::..:..:|   ::::::.|.|     :|.::|| |..|..:.|.
  Rat    84 QDQ---VDHLLALKVQVSSLNSKLSVQER---KELLSDLERDKPRTKLLYITPEMAASASFQPTL 142

  Fly   983 FGAILRQLPPIAFACIDEAHCVSQWSHNFRPSYLMICKVLRKNLGVRTVLGLTATATLPTRVSII 1047
            ...:.|.|  :::..:|||||||||.|:|||.||.: ..||..|.....:.||||||...:..:.
  Rat   143 NSLLSRNL--LSYLVVDEAHCVSQWGHDFRPDYLRL-GALRSRLAHAPCVALTATATPQVQEDVF 204

  Fly  1048 NHLGISDG---------ERGIISDIP----LPD---NLVLSVSKDENRD---AALLQLLNSERFE 1093
            ..|.:...         ...:..|:.    :||   ||         ||   .||.|..::....
  Rat   205 AALHLKQPVASFKTPCFRANLFYDVQFKELIPDVYGNL---------RDFCLKALGQKADNGSSS 260

  Fly  1094 PCQSIIIYCTRRDECERIAGFIRTCVQDRREPTQDQTKKRKRVNWQAEPYHAGMPASRRRTVQKA 1158
            .|.  |:||..|:.||::|..:.:                :.||  |:.||||:.||.|..||..
  Rat   261 GCG--IVYCRTREACEQLAIELSS----------------RGVN--AKAYHAGLKASERTQVQNE 305

  Fly  1159 FMSNELRIVVATIAFGMGINKPDIRAVIHYNMPRNFESYVQEIGRAGRDGLPSHCHLFLDAKGGD 1223
            :|..::.::||||:||||::|.::|.|.|:|:.::...|.||.|||||||.||.|.|:......|
  Rat   306 WMEEKVPVIVATISFGMGVDKANVRFVAHWNIAKSMAGYYQESGRAGRDGKPSWCRLYYSRNDRD 370

  Fly  1224 QSELRRHVYSNSIDRHVIRKLLQKI 1248
            |...            :|||.|.|:
  Rat   371 QVSF------------LIRKELAKL 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 129/384 (34%)
DEAD 872..1039 CDD:278688 66/179 (37%)
HELICc 1073..1216 CDD:238034 53/146 (36%)
Recql5NP_001099323.1 DEXDc 22..229 CDD:214692 72/219 (33%)
DEAD 31..201 CDD:278688 67/183 (37%)
DEAH box 157..160 3/3 (100%)
HELICc 258..363 CDD:238034 48/125 (38%)
RecQ_Zn_bind 368..435 CDD:292742 7/29 (24%)
Interaction with POLR2A. {ECO:0000250} 491..621
RecQ5 626..816 CDD:284397
Interaction with RAD51. {ECO:0000250} 653..726
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.