DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and drc1

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_593766.1 Gene:drc1 PomBaseID:SPAC6B12.11 Length:337 Species:Schizosaccharomyces pombe

Alignment Length:437 Identity:78/438 (18%)
Similarity:141/438 (32%) Gaps:146/438 (33%)


  Fly     1 MDDSVFKLKYQKYKLRVKVWEKDFKKKNGRVPSKYDIRDASQEIRDSYKMYYKLKTSFLEETLND 65
            |.|.....:....|..:|.||.::...|...|||.|:: ...||...||.||:||.   |.::..
pombe     1 MHDESRTKQISSIKALLKKWEHEYVHTNNCKPSKEDVK-KQPEIALLYKQYYELKR---ESSITP 61

  Fly    66 VLSEDGYDILEMSQASDFGVSMLDQDVSLNEGPQLPLDISALVGPQSSGNLEEIPQSVEGSFSNL 130
            ..::...|....:....      ..:...||.|:.|          .:..|:..|::|:.|....
pombe    62 KKAKTKVDFKFQTPTKQ------RAETEANESPKAP----------RNDYLQVTPKTVDKSLLGP 110

  Fly   131 IDLPNRQVLTNLVNRD---ENHVIRKFEAVEELPINQNAWGLNVSKKPPAP---PQPVEASKSAP 189
            ....:|:||..|.:..   ::||    :.:.:  |..|...::.:..|..|   |:||       
pombe   111 TPQLSRRVLNLLEDMSPIADSHV----DQISD--IKHNTSEISSTMIPTTPSKNPEPV------- 162

  Fly   190 GHGKQPKAGASLKPSLSAKLFQSSRGFAKRNPRKPLSRCVSSSSSTTSLSSVPTDHHEELLDFET 254
                                                      :..|.::...|:.:         
pombe   163 ------------------------------------------AQHTPTVLETPSSY--------- 176

  Fly   255 ILIRKAQEYKEKQQAIANNP--MLASEHSKESIKTLVDDGWLRRNTKENTLDEEVPFAEANNNSG 317
                :.|.|........|.|  ...||..:| :|.:.||   ..:.:|..|.|...|:.:::.| 
pombe   177 ----RLQVYTSPNLLRVNAPCRKSLSEMLRE-LKDIEDD---YGSNEEKILQEFESFSSSSSES- 232

  Fly   318 TSKKTNFGLANLDLSK-LKPTVKEEKVLQAKPDQMAIIQELQTDMNSSMNQKPDHLNHTPPASSQ 381
                    |.:.|:|: :|..:|.:..|...|              .|||....||...|     
pombe   233 --------LVDRDISQPMKKKIKRQNRLVKLP--------------PSMNLSKSHLEGLP----- 270

  Fly   382 KSVAPKNKPPPSEQETDSDSDSVVAESEE---EQEPQEYRQLSKRRK 425
                          |.|.|:::.:.::|:   .::...:..|...|:
pombe   271 --------------EIDEDAENGIDDNEDTTASKDSSPFLDLQSERQ 303

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588
DEAD 872..1039 CDD:278688
HELICc 1073..1216 CDD:238034
drc1NP_593766.1 Drc1-Sld2 10..336 CDD:288555 76/429 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004747
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.