DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and Wrn

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_001116294.1 Gene:Wrn MGIID:109635 Length:1401 Species:Mus musculus

Alignment Length:1071 Identity:259/1072 (24%)
Similarity:403/1072 (38%) Gaps:347/1072 (32%)


  Fly   538 DERQPLNPEDLKYVLALEAGDITSVPRINVQDLEEADATAQRY-------------IRTFAAGP- 588
            :|..||..:.....::.|..|:.:...:..::||    |.||.             :|....|| 
Mouse   237 EENLPLEMKKQLNSISEEMRDLANRFPVTCRNLE----TLQRVPVILKSISENLCSLRKVICGPT 297

  Fly   589 ------NPGLSEGSNIRVDEKRAAARKKLEERIAAGKLNENFVTINIQKKKFVRGKKSVNFSKYK 647
                  .||.|  .|:...|..|||.:| |::|                     ||.| .|:|.|
Mouse   298 NTETRLKPGSS--FNLLSSEDSAAAGEK-EKQI---------------------GKHS-TFAKIK 337

  Fly   648 KQQWRHKKRVAALSGPDMDMGGCDGGVLTCFQCGGVGHFAQQCKVKGDSLLPLSAQLEEDPSPFP 712
            ::.|          .|::|                                  |...:|:...|.
Mouse   338 EEPW----------DPELD----------------------------------SLVKQEEVDVFR 358

  Fly   713 TLAEAQEMASQGAVVAHSRNISRLPQAANAAILQGDELNESEEDDQESSGDEE--------VQQH 769
            ...:.::..|:..:   ..|:.|........|   ..::|:|..|.|....||        :.:|
Mouse   359 NQVKQEKGESENEI---EDNLLREDMERTCVI---PSISENELQDLEQQAKEEKYNDVSHQLSEH 417

  Fly   770 PDPN---------WSSDEMDVDFEALDAAVEASLSQPVSQEKAASPIKTYVGHKIPEEFLKQAGL 825
            ..||         ..||| |::.|.|.:.  .:|:..|.:...::.::.....::|.|.....|.
Mouse   418 LSPNDDENDSSYIIESDE-DLEMEMLKSL--ENLNSDVVEPTHSTWLEMGTNGRLPPEEEDGHGN 479

  Fly   826 DTTASSSNRSQHGGVKPLYDLLPDGSVQDTTPEVLEALH-MFGHTNFRKGQDRAIMRTL-SGLSS 888
            :..........|        |||:.:.:.     :..|. .|||::|:..|.:.|...| ....:
Mouse   480 EAIKEEQEEEDH--------LLPEPNAKQ-----INCLKTYFGHSSFKPVQWKVIHSVLEERRDN 531

  Fly   889 LVTLSTGSGKSLCYQLPAYLYSRKVGAITLVISPLVSLMEDQV-----TGVPHFLRAHCLHTNQT 948
            :|.::||.|||||:|.|. :|:.|:|   :|||||:|||||||     :.||..|..        
Mouse   532 VVVMATGYGKSLCFQYPP-VYTGKIG---IVISPLISLMEDQVLQLELSNVPACLLG-------- 584

  Fly   949 APQRMKIQQMIANGEIDILLVSPEAVVAGERATGFGAILRQLPP---IAFACIDEAHCVSQWSHN 1010
            :.|...|...:..|:..::.::||.      .:|...:|:||..   |....:|||||:|:|.|:
Mouse   585 SAQSKNILGDVKLGKYRVIYITPEF------CSGNLDLLQQLDSSIGITLIAVDEAHCISEWGHD 643

  Fly  1011 FRPSYLMICKVLRKNLGVRTVLGLTATATLPTRVSIINHLGISDGE---RGIISDIPLPDNLVLS 1072
            ||.|:.|:.. |:..|.:..|:.|:|||:...|..||:.|.:.|.:   .|.  |.|   ||.|.
Mouse   644 FRSSFRMLGS-LKTALPLVPVIALSATASSSIREDIISCLNLKDPQITCTGF--DRP---NLYLE 702

  Fly  1073 VSKDENRDAALLQLLN-------SERFEPCQSIIIYCTRRDECERIAGFIRTCVQDRREPTQDQT 1130
            |.:   :...:||.|.       |..:|.....||||..|...|::                  |
Mouse   703 VGR---KTGNILQDLKPFLVRKASSAWEFEGPTIIYCPSRKMTEQV------------------T 746

  Fly  1131 KKRKRVNWQAEPYHAGMPASRRRTVQKAFMSNELRIVVATIAFGMGINKPDIRAVIHYNMPRNFE 1195
            .:..::|.....|||||..|.|:.|...|:.:|::.||||:||||||||.|||.||||..|:..|
Mouse   747 AELGKLNLACRTYHAGMKISERKDVHHRFLRDEIQCVVATVAFGMGINKADIRKVIHYGAPKEME 811

  Fly  1196 SYVQEIGRAGRDGLPSHCHLFLDAKGGDQS---------------------ELRRHVYSNSIDRH 1239
            ||.|||||||||||.|.|||.......:.|                     ::.::::|:...|.
Mouse   812 SYYQEIGRAGRDGLQSSCHLLWAPADFNTSRNLLIEIHDEKFRLYKLKMMVKMEKYLHSSQCRRR 876

  Fly  1240 VI-----RKLLQKIFV------PCSCD---------------KEAS------------------K 1260
            :|     .|.|||..:      .| ||               ::||                  :
Mouse   877 IILSHFEDKCLQKASLDIMGTEKC-CDNCRPRLNHCLTANNSEDASQDFGPQAFQLLSAVDILQE 940

  Fly  1261 RTALPIP---LEG-------DGPRVHMC--PGHEIGFSVEKTVE--------MLDIPAENISTLL 1305
            :..:.||   |.|       |..|.|..  .|.|...|..||:.        ::::|.||     
Mouse   941 KFGIGIPILFLRGSNSQRLPDKYRGHRLFGAGKEQAESWWKTLSHHLIAEGFLVEVPKEN----- 1000

  Fly  1306 CYMELDPRWCISVLSSAYVMAKVISYGGPKYLKHAAKECPPLAMAIALQIRDKTFKE-----DSN 1365
                            .|:....::..|.|:|..|:.:.||   ::.||..::.|..     .||
Mouse  1001 ----------------KYIKTCSLTKKGRKWLGEASSQSPP---SLLLQANEEMFPRKVLLPSSN 1046

  Fly  1366 IIEFSVTDIAAGIGWNSGVVKYQLKDLEWVKVNGY------------PKRSPITVSFYDLGFRIK 1418
            .:....|..::    |........|.....:.:.|            ||:|.:..|         
Mouse  1047 PVSPETTQHSS----NQNPAGLTTKQSNLERTHSYKVPEKVSSGTNIPKKSAVMPS--------- 1098

  Fly  1419 VPGD--------FTESEIDNALDTLYTRSVK 1441
             ||.        .:..|:| |...||.|.|:
Mouse  1099 -PGTSSSPLEPAISAQELD-ARTGLYARLVE 1127

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 137/374 (37%)
DEAD 872..1039 CDD:278688 60/176 (34%)
HELICc 1073..1216 CDD:238034 62/150 (41%)
WrnNP_001116294.1 Interaction with WRNIP1. {ECO:0000269|PubMed:11301316} 1..271 7/38 (18%)
RNaseD_like 55..223 CDD:176650
rnd <156..>344 CDD:130455 32/146 (22%)
recQ_fam 502..975 CDD:129701 160/519 (31%)
DEAD 515..676 CDD:278688 61/180 (34%)
DEAH box 632..635 3/3 (100%)
HELICc 718..832 CDD:238034 58/132 (44%)
RecQ_Zn_bind 837..904 CDD:292742 11/68 (16%)
RQC 923..1016 CDD:214936 18/114 (16%)
Interaction with DNA. {ECO:0000250} 952..958 1/6 (17%)
HRDC 1116..1194 CDD:128635 6/14 (43%)
HTH_40 1226..1316 CDD:291179
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.