DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and Recql

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_001342440.1 Gene:Recql MGIID:103021 Length:648 Species:Mus musculus

Alignment Length:705 Identity:173/706 (25%)
Similarity:294/706 (42%) Gaps:169/706 (24%)


  Fly   782 DFEALDAAVE--ASLSQPVSQEKA--ASPIKTYVGHKIPEEFLKQAGLDTTASSSNRSQHGGVKP 842
            :..|:|..::  ....|.:.|.|:  ...||.|:.....|   ..:.|||:.::.|:...    |
Mouse    17 ELHAIDIQIQELTERRQELLQRKSVLTGKIKQYLEDSSAE---ASSDLDTSPAAWNKEDF----P 74

  Fly   843 LYDLLPDGSVQDTTPEVLEALHMFGHTNFRKGQDRAIMRTLSGLSSLVTLSTGSGKSLCYQLPAY 907
            .:     |.|:|    ||:  ::|....||..|...|..|::.....:.:.||.||||||||||.
Mouse    75 WF-----GKVKD----VLQ--NVFKLQKFRPLQLETINVTMARKDIFLVMPTGGGKSLCYQLPAL 128

  Fly   908 LYSRKVGAITLVISPLVSLMEDQVTGVPHFLRAHCLHTNQTAPQRMK---IQQMIANGEIDILLV 969
            ...    ..||||.||:||||||:..:.....:..:....::.:.:|   .:.:..|.::.::.|
Mouse   129 CSD----GFTLVICPLISLMEDQLMVLKQLGISATMLNASSSKEHVKWVHAEMVNKNSQLKLIYV 189

  Fly   970 SPEAVVAGE-------------RATGFGAILRQLPPIAFACIDEAHCVSQWSHNFRPSYLMICKV 1021
            :||.:...:             |.||             |.:||.||.|||.|:|||.|..: .:
Mouse   190 TPEKIAKSKMFMSRLEKAYEAGRLTG-------------AAVDEVHCCSQWGHDFRPDYKAL-GI 240

  Fly  1022 LRKNLGVRTVLGLTATATLPTRVSIINHLGISDGER--------GIISDIPLPDNLVLSV----S 1074
            |::.....:::|||||||        ||: :.|.::        ...:....| ||...|    |
Mouse   241 LKRQFPNASLMGLTATAT--------NHV-LKDVQKILCVGKCLTFTASFNRP-NLFYEVRQKPS 295

  Fly  1075 KDENRDAALLQLLNSERFEPCQSIIIYCTRRDECERIAGFIRTCVQDRREPTQDQTKKRKRVNWQ 1139
            ..|:....:::|:|. |::. ||.||||..:.:.|:|                  |...:::...
Mouse   296 SAEDFTEDIVKLING-RYKG-QSGIIYCFSQKDSEQI------------------TISLQKLGIH 340

  Fly  1140 AEPYHAGMPASRRRTVQKAFMSNELRIVVATIAFGMGINKPDIRAVIHYNMPRNFESYVQEIGRA 1204
            |..|||.|....:..|...:.:|||::||||:||||||:|||:|.|||::|.::.|:|.||.|||
Mouse   341 AGTYHANMEPEDKTKVHTQWSANELQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRA 405

  Fly  1205 GRDGLPSHCHLFLDAKGGD--------------QSELRRHV-YSNSID---RHVIRKLLQKIFVP 1251
            |||...:.|.|:...  ||              |.:|...| |..::.   |.:|.:...:::..
Mouse   406 GRDDSRADCILYYGF--GDIFRISSMVVMENVGQQKLYEMVSYCQNVSKCRRVLIAQHFDEVWNA 468

  Fly  1252 CSCDKEASK----------------RTALPIPLEGDGPRVHMCPGHEIGFSVEKTVEMLDI---- 1296
            .:|:|....                |..:.|..:.:|....:.|...|...:.|....|.:    
Mouse   469 DACNKMCDNCCKDVSFEKKNVTQHCRDLIKILKQAEGLNEKLTPLKLIDAWMGKGAAKLRVAGVV 533

  Fly  1297 ----PAENISTL---------------------LCYMELDPRWCISVLSSAYVMAKVISYGGPKY 1336
                |.|::..:                     :.|:::.||.|: :.:.|:.:...:.......
Mouse   534 APALPREDLERIVAHALLQQYLKEDYSFTAYATISYLKVGPRACL-LSNEAHAVTMQVKKSAQSS 597

  Fly  1337 LKHAAKECPPLAMAIALQIRDKTFKEDSNIIEFSVTDIAAGIGWNSGVVKYQLKD 1391
            ::.|..|...:.     |:..|..::.|...:.|.:.:......|:|..|.:|.|
Mouse   598 VRGALSEARQVE-----QVDSKGEEQSSGNSQKSKSRLQPSGSKNAGAKKRKLDD 647

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 119/382 (31%)
DEAD 872..1039 CDD:278688 56/183 (31%)
HELICc 1073..1216 CDD:238034 54/147 (37%)
RecqlNP_001342440.1 DEXDc 81..543 CDD:331760 141/518 (27%)
DEVH box 219..222 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.