DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and him-6

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_502390.2 Gene:him-6 WormBaseID:WBGene00001865 Length:988 Species:Caenorhabditis elegans

Alignment Length:660 Identity:186/661 (28%)
Similarity:290/661 (44%) Gaps:129/661 (20%)


  Fly   684 GHFA----QQCKVKGDSLL--PLSAQLEEDPSPFPTLAEAQEMASQGAVVAHSRNISRLPQAANA 742
            ||::    ||...:....|  |....|:|:| |...|.::.:....|              :.:.
 Worm   101 GHYSFNEYQQFPSRPQKRLVDPPIVDLDEEP-PIVDLDDSFDNFHVG--------------STSE 150

  Fly   743 AILQGDELNESEEDDQESSGDEEVQQHPDPNWSSDEMDVDFEALDAAVEASLSQPVSQEKAASPI 807
            .::.||...|.||::...|.|                  |||::.|       ||.|:...||  
 Worm   151 EVVSGDIAPEEEEEEGHDSFD------------------DFESVPA-------QPPSKNTLAS-- 188

  Fly   808 KTYVGHKIPEEFLKQAGLDTTASSSNRSQHGGVKPLYDLLPDGSVQ----------DTTPEVLEA 862
                        |:::..:...:......||..:   ..|.|.|.:          |...|:.:.
 Worm   189 ------------LQKSDSEIALNQQRHDMHGRFR---GFLQDDSEEFSDEVGLLGADMNKELYDT 238

  Fly   863 L-HMFGHTNFRKGQDRAIMRTLSGLSSLVTLSTGSGKSLCYQLPAYLYSRKVGAITLVISPLVSL 926
            | ..||...||..|.:.|:.||.|..:.|.:.||:||||||||||.:    :..:|:|:|||.||
 Worm   239 LKSKFGFNQFRHRQKQCILSTLMGHDTFVLMPTGAGKSLCYQLPAVI----LPGVTVVVSPLRSL 299

  Fly   927 MEDQVTGVPHF-LRAHCLHTNQTAPQRMKIQQMIANG--EIDILLVSPEAVVAGERATGFGAILR 988
            :|||...:... :....|..:..||.:.||...:.:|  .|.:|.|:||.:.|..|.......|.
 Worm   300 IEDQKMKMKELGIGCEALTADLGAPAQEKIYAELGSGNPSIKLLYVTPEKISASGRLNSVFFDLH 364

  Fly   989 QLPPIAFACIDEAHCVSQWSHNFRPSYLMICKVLRK--NLGVRTVLGLTATATLPTRVSIINHLG 1051
            :...:|...||||||||||.|:|||.|..:..:..|  |..| .::.||||||........:||.
 Worm   365 RRGLLARFVIDEAHCVSQWGHDFRPDYTKLSSLREKYANPPV-PIIALTATATPKIVTDARDHLK 428

  Fly  1052 ISDGERGIISDIPLPDNLVLSVSKDENRDAALLQLLN----SERFEPCQSIIIYCTRRDECERIA 1112
            :.:.:..|.|.:  .|||     |.:....|...|:|    .::..|.:|.|:||..|.|||.:.
 Worm   429 MQNSKLFISSFV--RDNL-----KYDLIPKAARSLINVVEKMKQLYPGKSGIVYCLSRKECETVQ 486

  Fly  1113 GFIRTCVQDRREPTQDQTKKRKRVNWQAEPYHAGMPASRRRTVQKAFMSNELRIVVATIAFGMGI 1177
            ..:                  .:....||.||||:..:.|.:||:::::|:..::.|||||||||
 Worm   487 MML------------------TKAGLSAEVYHAGLNDNLRVSVQRSWIANKFDVICATIAFGMGI 533

  Fly  1178 NKPDIRAVIHYNMPRNFESYVQEIGRAGRDGLPSHCHLFLDAKGGDQSELRRHVYSNSIDRHV-- 1240
            :|||:|.||||::|::.|.|.||.|||||||:||:|.:.....  |...|||.:...:....|  
 Worm   534 DKPDVRFVIHYSLPKSIEGYYQETGRAGRDGMPSYCLMLYSYH--DSIRLRRMIEEGNTTTGVRS 596

  Fly  1241 --IRKLLQKIFVPCSCDKEASKRTALPIPLEGDGPRVHMCPGHEIGFSV-------EKTVEMLDI 1296
              :..:||   |...|:..:..|..:.:...|:......|...:....:       .:.:.:.|:
 Worm   597 MHLNNVLQ---VVAYCENVSVCRRKMLVEHFGEVYDEQSCRNSKTPCDICERQRKNAEAIRLFDV 658

  Fly  1297 PAENISTLLC 1306
            ..:.:|.|.|
 Worm   659 STDALSILKC 668

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 133/363 (37%)
DEAD 872..1039 CDD:278688 67/172 (39%)
HELICc 1073..1216 CDD:238034 55/147 (37%)
him-6NP_502390.2 RecQ 231..881 CDD:223588 151/474 (32%)
DEAD 252..419 CDD:278688 67/172 (39%)
HELICc 443..572 CDD:238034 57/152 (38%)
RecQ_Zn_bind 577..643 CDD:292742 12/69 (17%)
RQC 653..772 CDD:286470 4/17 (24%)
HRDC 807..888 CDD:128635
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.