DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RecQ4 and him-6

DIOPT Version :10

Sequence 1:NP_652607.1 Gene:RecQ4 / 53438 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_502390.2 Gene:him-6 / 178201 WormBaseID:WBGene00001865 Length:988 Species:Caenorhabditis elegans


Alignment Length:160 Identity:36/160 - (22%)
Similarity:59/160 - (36%) Gaps:28/160 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 RVLKWTYAYGFYIPDQEHGKRVFFEYLQGEAESGLERLHQCA--EKELLPYLDAKGPSEDFNEFR 482
            |:|||..|...|   .:||......|....|..|..:|...:  ..:|.|..:..|.|.:.:|. 
 Worm   763 RLLKWIDAGVVY---HKHGVGGLLRYAAVLASGGDAQLSSSSILALDLTPAENGAGESTNVSEM- 823

  Fly   483 TKLAGLTSVTKNYFENLVRAL-ENGLSDVNSHDA--YDRTSSSKSLGGKTKGSSSKASSSDSSHW 544
                       |..:||.:.: |.....||..|:  ...|::.:.|...:..|:..|:..|....
 Worm   824 -----------NVLDNLGKVIFEKSFEGVNLSDSSISQLTTALRILALISDNSTVAAALYDEGAV 877

  Fly   545 PCEY-----CTYVNPRSTTICQMC---EHG 566
            ...|     |:::..||:.|....   :||
 Worm   878 TVVYAILVNCSFMFERSSNIYDYLVDDDHG 907

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQL4_SLD2_NTD 9..55 CDD:412085
RecQ 855..>1216 CDD:440280
him-6NP_502390.2 RecQ 231..728 CDD:440280
HRDC 807..888 CDD:128635 18/92 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.