DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and rcq-5

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_001309439.1 Gene:rcq-5 WormBaseID:WBGene00004322 Length:821 Species:Caenorhabditis elegans

Alignment Length:902 Identity:217/903 (24%)
Similarity:347/903 (38%) Gaps:287/903 (32%)


  Fly   756 DDQESSGDEEVQQHPDPNWSS------------------------DEMDVDFEALDAAV------ 790
            ||.:...|:|.......|:::                        .|.:...:.|..|:      
 Worm    22 DDSDEETDKEPAAKKPSNYTAWAEIFNKKKTESSAVSAIEKAKKDSEKERQRQKLREAIMERKRR 86

  Fly   791 EASLSQPVSQEKAASPIKTY-----VGHKI---PEEFLKQAGLDTTASSSNR-SQHGGVKPLYDL 846
            ||.:::|..|:  ..|:.|.     |..||   .|:|      |.:..|::| :|...:.| .|.
 Worm    87 EALMNEPKKQK--IEPVSTVKLEKSVNQKISANSEDF------DVSGPSNSRETQESPLDP-NDF 142

  Fly   847 LPDGSVQDTTPEVLEA-----------LHMFGHTNFRKGQDRAIMRTLSGL-----SSLVTLSTG 895
            :.:.....|...::..           |.:|.|..:|   .|..|:.::.:     ...|:|.||
 Worm   143 VANPLAIGTGERLIRGQDIIERRDKVFLELFCHKKYR---SRLQMQAINCILKRKCDVYVSLPTG 204

  Fly   896 SGKSLCYQLPAYLYSRKVGAITLVISPLVSLMEDQVT-----GVPHFLRAHCLHTNQTAPQRMKI 955
            :||||||||||.::    |.||:|||||::||:||::     |:|    ...|::..|..:|.:|
 Worm   205 AGKSLCYQLPAVVH----GGITVVISPLIALMKDQISSLKRKGIP----CETLNSTLTTVERSRI 261

  Fly   956 QQMIANGE--IDILLVSPEAVVA-GERATGFGAILRQLPPIAFACIDEAHCVSQWSHNFRPSYLM 1017
            ...:|..:  |.:|.::.|.|.. |.:....|...|.:  :.:..:||||||:||.|:|||.||.
 Worm   262 MGELAKEKPTIRMLYLTAEGVATDGTKKLLNGLANRDV--LRYIVVDEAHCVTQWGHDFRPDYLT 324

  Fly  1018 ICKVLRKNLGVRTVLGLTATATLPTRVSIINHLGISDGER--------GIISDIPLPDNLVLSVS 1074
            :..:.....||..| .|||||....:..|...|.:.:.|.        .:..|:.:.|:|   .:
 Worm   325 LGSLRDVCPGVPWV-ALTATANAKAQDDIAFQLKLRNPESFKSGTYRDNLFYDVAMRDHL---AT 385

  Fly  1075 KDENRDAALL-------------QLLNSERFEPCQ-------SIIIYCTRRDECERIAGFIRTCV 1119
            ..||..|:.:             .|...|:.|..|       |.|:||..|:||.::|       
 Worm   386 APENHMASFITKCLTVDAKTSSSNLTKHEKAERSQNKKTFTGSAIVYCRSRNECGQVA------- 443

  Fly  1120 QDRREPTQDQTKKRKRVNWQAEPYHAGMPASRRRTVQKAFMSNELRIVVATIAFGMGINKPDIRA 1184
                       |..:.....|..||||:....|..||:.:|:||:.:|.||:||||||:|||:||
 Worm   444 -----------KMLEIAGIPAMAYHAGLGKKDRNEVQEKWMNNEIPVVAATVAFGMGIDKPDVRA 497

  Fly  1185 VIHYNMPRNFESYVQEIGRAGRDGLPSHCHLFLDAKGGDQSELRRHVYSNSIDRHVIRKLLQKIF 1249
            |||::..:|...|.||.|||||||..|:|.::...:  |::.|      |.:....:.||.:|  
 Worm   498 VIHWSPSQNLAGYYQEAGRAGRDGKRSYCRIYYSKQ--DKNAL------NFLVSGELAKLREK-- 552

  Fly  1250 VPCSCDKEASKRTALPIPLEGDGPRVHMCPGHEIGFSVEKTVEMLDIPAENISTLLCYMELDPRW 1314
                    |.|..|     ||                     |..::..::|.|.|         
 Worm   553 --------AKKNNA-----EG---------------------EKAEMQIKSIQTGL--------- 574

  Fly  1315 CISVLSSAYVMAKVISYGGPKYLKHAA-------KECPPLAMAIALQIRDKTFKEDSNIIEFSVT 1372
                       ||::.|......:|.:       .||.| ........||.| |...|:..|..:
 Worm   575 -----------AKMLEYCESARCRHVSIASFFDDTECRP-CKTNCDYCRDPT-KTIRNVEAFINS 626

  Fly  1373 DIAAGIGW-----NSGVVKYQLKDLEWVKVNGYPKRSPITVSFYDLGFRIKVPGDFTESEIDNAL 1432
            :.:.|...     :||             .:|:.       |.|..|.|    |..||.|:.:|.
 Worm   627 EASTGRSMFRKSASSG-------------ESGFD-------SVYGGGKR----GGETEDELLSAA 667

  Fly  1433 DTLYTRSVKQERTQLIQLQYVAHGLAAVAYSSCGQCCNADFPQDRGEQLKAIVRNYFAN-----D 1492
            .|......:.|                               |:..:::::::...||.     .
 Worm   668 STSKDAMDRME-------------------------------QEEAKRVRSVISQEFAKRRQAAP 701

  Fly  1493 YPQDLELEIEPS---NV--PDENIIDDVHALINMYPDNTFTGRNIARIFHGIMSPNY 1544
            .|:.....:||:   ||  |::|:|.:|         ...|..|..|..|..:..|:
 Worm   702 PPRATARRVEPATDVNVIKPEQNVIKNV---------TLETRENWVRFLHRALDSNW 749

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 130/395 (33%)
DEAD 872..1039 CDD:278688 65/180 (36%)
HELICc 1073..1216 CDD:238034 57/163 (35%)
rcq-5NP_001309439.1 DEAD 180..350 CDD:278688 64/181 (35%)
RecQ 182..>617 CDD:223588 152/533 (29%)
HELICc <427..529 CDD:238034 50/120 (42%)
RecQ_Zn_bind 558..610 CDD:292742 14/99 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.