DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and K02F3.12

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_001022656.1 Gene:K02F3.12 WormBaseID:WBGene00019334 Length:631 Species:Caenorhabditis elegans

Alignment Length:653 Identity:172/654 (26%)
Similarity:278/654 (43%) Gaps:155/654 (24%)


  Fly   772 PNWSSD----EMDVDFEALDAAVEASLSQPVSQEKAASPIKTYVGHKIPEEFLKQAGLDTTASSS 832
            |:..||    ::..:...||..: ..:.|.:||.:......|.....|..:...:...|:...:.
 Worm    21 PDLMSDVLLSKLSTELADLDGEI-GQIDQQISQLRRKKSELTQKRQAIERKIELKTNEDSDVVTD 84

  Fly   833 NRSQHGGVKPLYDLLPDGSVQDTTPEVLEALHMFGHTNFRKGQDRAIMRTLSGLSSLVTLSTGSG 897
            ...:.|  .|..|        :.|..:.|..|:   ..||..|..||...:|...::|.||||.|
 Worm    85 RWDRDG--FPWSD--------EATKILKEQFHL---EKFRPLQRAAINAVMSKEDAVVILSTGGG 136

  Fly   898 KSLCYQLPAYLYSRKVGAITLVISPLVSLMEDQVTGVPHF-LRAHCLHTNQTAPQRMKIQQMIAN 961
            |||||||||.|    ...:.||:|||:||:|||:..:... :.:..|:.|.:..:..:::..|.|
 Worm   137 KSLCYQLPALL----ANGLALVVSPLISLVEDQILQLRSLGIDSSSLNANTSKEEAKRVEDAITN 197

  Fly   962 --GEIDILLVSPEAVVAGER---------ATGFGAILRQLPPIAFACIDEAHCVSQWSHNFRPSY 1015
              .:..:|.|:||.:...::         :.||         :....|||.||.|||.|:||..|
 Worm   198 KDSKFRLLYVTPEKLAKSKKMMNKLEKSLSVGF---------LKLIAIDEVHCCSQWGHDFRTDY 253

  Fly  1016 LMICKVLRKNLGVRTVLGLTATATLPTRVSIINHLGI------------SDGERGIISDIPLPDN 1068
            ..:..:.|:..|| .:||||||||......:.:.|||            |:.:..::......|.
 Worm   254 SFLNVLKRQFKGV-PILGLTATATSNVLDDVKDMLGIQAALTFRAGFNRSNLKYKVVQKPGSEDE 317

  Fly  1069 LVLSVSKDENRDAALLQLLNSERFEPCQSIIIYCTRRDECERIAGFIRTCVQDRREPTQDQTKKR 1133
            ....::|...||.|            .|:.||||..|::||::|                  |..
 Worm   318 CTEEIAKTIKRDFA------------GQTGIIYCLSRNDCEKVA------------------KAL 352

  Fly  1134 KRVNWQAEPYHAGMPASRRRTVQKAFMSNELRIVVATIAFGMGINKPDIRAVIHYNMPRNFESYV 1198
            |....:|:.|||.|....|....:.::|.:::::|||:||||||:||::|.|||:::|::.|:|.
 Worm   353 KSHGIKAKHYHAYMEPVDRSGAHQGWISGKIQVIVATVAFGMGIDKPNVRFVIHHSLPKSIENYY 417

  Fly  1199 QEIGRAGRDGLPSHCHLFL-------------DAKGGDQS--ELRRHVYSNSIDRHV-IRKLLQK 1247
            ||.|||||||.|:.|.|:.             ..:.|.|:  .:.|:...:|..|.| :.:..::
 Worm   418 QESGRAGRDGQPATCILYYRLADIFKQSSMVQQERTGIQNLYNMVRYAADSSTCRRVKLAEHFEE 482

  Fly  1248 IFVPCSCDK-----------------------EASKRTA------LPIPLEGDGPRVHMCPGHEI 1283
            .:.|..|.|                       ||:|.|.      |....:|.| |:        
 Worm   483 AWEPSWCQKQCDTCENGNGFVGTSSKESTDVSEAAKTTVRIIEEHLNSAKDGSG-RI-------- 538

  Fly  1284 GFSVEKTVEML----------DIPAENISTLLC--YMELDPRWCI-SVLSSAYVMAKVISYGGPK 1335
              :..|.||:|          :...:.|..||.  |::.|..:.: ||:|...:.:|...|.|..
 Worm   539 --TGNKLVELLTKKLKGSRNREFCEKLIVNLLLEGYLQEDFHYTVYSVISYVVIGSKWRVYNGKD 601

  Fly  1336 YLK 1338
            .:|
 Worm   602 AIK 604

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 123/391 (31%)
DEAD 872..1039 CDD:278688 63/179 (35%)
HELICc 1073..1216 CDD:238034 52/143 (36%)
K02F3.12NP_001022656.1 recQ_fam 99..571 CDD:129701 148/530 (28%)
DEAD 111..281 CDD:278688 64/184 (35%)
HELICc 303..435 CDD:238034 53/162 (33%)
RecQ_Zn_bind 440..496 CDD:292742 9/56 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.