DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and Recql5

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:XP_006532421.1 Gene:Recql5 MGIID:2156841 Length:983 Species:Mus musculus

Alignment Length:415 Identity:136/416 (33%)
Similarity:207/416 (50%) Gaps:85/416 (20%)


  Fly   865 MFGHTNFRKG-QDRAIMRTLSGLSSL-VTLSTGSGKSLCYQLPAYLYSRKVGAITLVISPLVSLM 927
            :||..:|:.. |:.|.|..:.|...: |.:.||:||||||||||.|.|    .||:|:|||::|:
Mouse    24 VFGFDSFKTPLQESATMAVVKGAEDVFVCMPTGAGKSLCYQLPALLAS----GITIVVSPLIALI 84

  Fly   928 EDQVTGVPHFL----RAHCLHTNQTAPQRMKIQQMIANGEID-----ILLVSPE-AVVAGERATG 982
            :||   |.|.|    :...|::..:..:|   ::::::.|.|     :|.::|| |..|..:.|.
Mouse    85 QDQ---VDHLLALKVQVSSLNSKLSVQER---KELLSDLERDKPRTKLLYITPEMAASASFQPTL 143

  Fly   983 FGAILRQLPPIAFACIDEAHCVSQWSHNFRPSYLMICKVLRKNLGVRTVLGLTATATLPTRVSII 1047
            ...:.|.|  :::..:|||||||||.|:|||.||.: ..||..|.....:.||||||...:..:.
Mouse   144 NSLVSRNL--LSYLVVDEAHCVSQWGHDFRPDYLRL-GALRSRLAHAPCVALTATATPQVQEDVF 205

  Fly  1048 NHLGISDG---------ERGIISDIP----LPD---NLVLSVSKDENRDAALLQLLNSERFEPCQ 1096
            ..|.:...         ...:..|:.    :||   ||         ||..|..|  .::.|...
Mouse   206 AALHLKQPVASFKTPCFRANLFYDVQFKELIPDVYGNL---------RDFCLKAL--GQKAENGS 259

  Fly  1097 SI---IIYCTRRDECERIAGFIRTCVQDRREPTQDQTKKRKRVNWQAEPYHAGMPASRRRTVQKA 1158
            |.   |:||..|:.||::|..:.:                :.||  |:.||||:.||.|..||..
Mouse   260 SSGCGIVYCRTREACEQLAIELSS----------------RGVN--AKAYHAGLKASDRTQVQNE 306

  Fly  1159 FMSNELRIVVATIAFGMGINKPDIRAVIHYNMPRNFESYVQEIGRAGRDGLPSHCHLFLDAKGGD 1223
            :|..::.::||||:||||::|.::|.|.|:|:.::...|.||.|||||||.||.|.|:......|
Mouse   307 WMEEKVPVIVATISFGMGVDKANVRFVAHWNIAKSMAGYYQESGRAGRDGKPSWCRLYYSRNDRD 371

  Fly  1224 QSELRRHVYSNSIDRHVIRKLLQKI 1248
            |...            :|||.|.|:
Mouse   372 QVSF------------LIRKELAKL 384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 129/384 (34%)
DEAD 872..1039 CDD:278688 66/179 (37%)
HELICc 1073..1216 CDD:238034 53/146 (36%)
Recql5XP_006532421.1 DEXDc 23..230 CDD:214692 72/219 (33%)
DEAD 32..202 CDD:278688 67/183 (37%)
HELICc 259..364 CDD:238034 48/123 (39%)
RecQ_Zn_bind 369..436 CDD:292742 7/29 (24%)
RecQ5 627..818 CDD:284397
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.