DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and Blm

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_031576.4 Gene:Blm MGIID:1328362 Length:1419 Species:Mus musculus

Alignment Length:1367 Identity:308/1368 (23%)
Similarity:508/1368 (37%) Gaps:422/1368 (31%)


  Fly   342 KVLQAKPDQMAIIQELQTDMNSSMNQKPDHLNHTPPASSQKSVAPKNKPPPSEQETDSDSDSVV- 405
            :::.|.|     :..||..:.....:|   ||:.|..|..||:....|...||.:....|.||| 
Mouse     2 RIMAAVP-----LNNLQEQLQRHSARK---LNNQPSLSKPKSLGFTFKKKTSEGDVSVTSVSVVK 58

  Fly   406 --AESEEE--------------QEPQE-------YRQLSKRRKIVSTASGKVEVAAPVEIPNKVE 447
              |.|:::              .:|::       ::....|::...|.|   |.:.|..:....:
Mouse    59 TPALSDKDVNVSEAFSFTESPLHKPKQQAKIEGFFKHFPGRQQSKGTCS---EPSLPATVQTAQD 120

  Fly   448 -----PETETFAQENP-------DFSA------------DEDQDATYVPENKKKDKAKRKQAAGK 488
                 |:|.| |::.|       :||:            |.|..|:....:..|:.|.|...|.|
Mouse   121 TLCTTPKTPT-AKKLPVAVFKKLEFSSSADSLSDWADMDDFDMSASDAFASLAKNPATRVSTAQK 184

  Fly   489 QKTTK-------PKAEPKPKTE--------------KKAKVKAEKKPKAEKKPRNSKKAIAVEPA 532
            .|.||       |:.....||:              |:::.:.|::.:||.....|:..|.::..
Mouse   185 MKKTKRNFFKPPPRKANAVKTDLTPPSPECLQVDLTKESEEEEEEEEEAEGADCLSRDVICIDND 249

  Fly   533 PDPEE-DERQPLNPEDLKYVLALEAG-----------------------------DITSVP---- 563
            ...|| .|:.....:.||..|..|.|                             ||..||    
Mouse   250 SASEELTEKDTQESQSLKAHLGAERGDSEKKSHEDEAVFHSVQNTEYFEHNDNDYDIDFVPPSPE 314

  Fly   564 ------------RINVQDLEEAD------ATAQRYIRTFAAGP--------NPGLS---EGSNIR 599
                        ...::||:::|      :|::..:    :.|        :.|.|   :...||
Mouse   315 EIISTASSSLKCSSMLKDLDDSDKEKGILSTSEELL----SKPEEMTTHKSDAGTSKDCDAQQIR 375

  Fly   600 VDEKRAAARK---KLEERIAAGKL------NENFVTINIQKKKFVRGKKSVNFSKYKKQQWRHKK 655
            :.::.....:   ||.:.:...:|      .|.....||::|.......:.|..:.....|||: 
Mouse   376 IQQQLIHVMEHICKLVDTVPTDELEALNCGTELLQQRNIRRKLLAEAGFNGNDVRLLGSLWRHR- 439

  Fly   656 RVAALSGPDMDMGGCDGGVLTCFQCGGVGHFAQQCKVKGDSLLPLSAQLEE-----DPSPFPTLA 715
                   ||.......|.  :|    .|||  ...::....||..|...||     .|......|
Mouse   440 -------PDSLDNTVQGD--SC----PVGH--PNKELNSPYLLSHSPSTEECLPTTTPGKTGFSA 489

  Fly   716 EAQEMASQGAVVAH------SRNISRLPQAANAAILQGDELNESEE-------------DDQESS 761
            ..:.:..:..:.:|      |.|.:..|:..|.        |||.:             ..::::
Mouse   490 TPKNLFERPLLNSHLQKSFVSSNWAETPRMENR--------NESTDFPGSVLTSTTVKAQSKQAA 546

  Fly   762 GDEEVQQHPDPNWSSDEMDV-DFEALD-------------AAVEASLSQPVSQEKAASPIKTYVG 812
            ....|::|...::..|..:: ||:..|             |:..::.:.|..:|  ..|:|: :.
Mouse   547 SGWNVERHGQASYDIDNFNIDDFDDDDDDDDWENIMHNFPASKSSTATYPPIKE--GGPVKS-LS 608

  Fly   813 HKIPEEFLKQAGLDTTASSSNRSQHGGVKPLYDLLPDGSVQDT-------------TPEVLEALH 864
            .:|.....|...:.:||.::|.|:  .::...|.|........             |.|:::..|
Mouse   609 ERISSAKAKFLPVVSTAQNTNLSE--SIQNCSDKLAQNLSSKNPKHEHFQSLNFPHTKEMMKIFH 671

  Fly   865 -MFGHTNFRKGQDRAIMRTLSGLSSLVTLSTGSGKSLCYQLPAYLYSRKVGAITLVISPLVSLME 928
             .||..|||..|..||...|.|....:.:.||.||||||||||.:..    .:|:|||||.||:.
Mouse   672 KKFGLHNFRTNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSP----GVTIVISPLRSLIV 732

  Fly   929 DQVTGVPHF-LRAHCLHTNQTAPQRMKIQQMIANGE--IDILLVSPEAVVAGERATGFGAILRQL 990
            |||..:..| :.|..|..::|..:...|...::..:  |.:|.|:||.|.|..|.......|.:.
Mouse   733 DQVQKLTSFDIPATYLTGDKTDSEAANIYLQLSKKDPIIKLLYVTPEKVCASNRLISTLENLYER 797

  Fly   991 PPIAFACIDEAHCVSQWSHNFRPSYLMICKVLRKNLGVRTVLGLTATATLPTRVSIINHLGISDG 1055
            ..:|...||||||||||.|:||..|..: .:||:......|:.|||||....:..|:..|.|...
Mouse   798 KLLARFVIDEAHCVSQWGHDFRQDYKRM-NMLRQKFPSVPVMALTATANPRVQKDILTQLKILRP 861

  Fly  1056 ERGIISDIPLPDNLVLSVSKDENRDAALLQLLNSERFEPCQSIIIYCTRRDECERIAGFIRTCVQ 1120
            :  :.|......||...|...:.:..|...|....:..|..|.||||..|.||:.:|..:     
Mouse   862 Q--VFSMSFNRHNLKYYVLPKKPKKVAFDCLEWIRKHHPYDSGIIYCLSRRECDTMADTL----- 919

  Fly  1121 DRREPTQDQTKKRKRVNWQAEPYHAGMPASRRRTVQKAFMSNE-LRIVVATIAFGMGINKPDIRA 1184
                         :|....|..||||:..|.|..||..:::.: .:::.|||||||||:|||:|.
Mouse   920 -------------QREGLAALAYHAGLSDSARDEVQHKWINQDNCQVICATIAFGMGIDKPDVRF 971

  Fly  1185 VIHYNMPRNFESYVQEIGRAGRDGLPSHCHLFLDAKGGDQSELRRHVYSNSIDRHVIRKLLQKIF 1249
            |||.::|::.|.|.||.|||||||..|||.||             :.|      |.:.:|     
Mouse   972 VIHASLPKSMEGYYQESGRAGRDGEISHCVLF-------------YTY------HDVTRL----- 1012

  Fly  1250 VPCSCDKEASKRTALPIPLEGDG-------------PRVHMCPG-------------HEIGFSVE 1288
                      ||.   |.:|.||             ..||.|..             .|.||:.:
Mouse  1013 ----------KRL---IMMEKDGNYHTKETHVNNLYSMVHYCENITECRRIQLLAYFGEKGFNPD 1064

  Fly  1289 KTVEMLDIPAEN---------------ISTLLCYME----------LDP--RWCISVLSSAYV-- 1324
            ...:..|:..:|               :..::.:::          :.|  |:.:::|...::  
Mouse  1065 FCKKYPDVSCDNCCKTKDYKTKDVTDDVKNIIRFVQEHSSSPGTRNIGPAGRFTLNMLVDIFLGS 1129

  Fly  1325 -MAKVIS--YG-GPKYLKHAAKECPPLAMAIALQIRDKTFKEDSNIIEFSVTDIAAGIGWNSGVV 1385
             .|||.|  :| |..|.:|.|               ::.||:   :|...:.|            
Mouse  1130 KSAKVKSGIFGKGTTYSRHNA---------------ERLFKK---LILDKILD------------ 1164

  Fly  1386 KYQLKDLEWVKVNGYPKRSPITVSFYDLGFR--------IKVPGDFTESEIDNALDTLYTRSVKQ 1442
                :|| ::..|..|      :::..||.:        :||  ||.|:|        .:.|:|:
Mouse  1165 ----EDL-YINANDQP------IAYVMLGTKAHSVLSGHLKV--DFMETE--------NSSSIKK 1208

  Fly  1443 ER 1444
            ::
Mouse  1209 QK 1210

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 133/359 (37%)
DEAD 872..1039 CDD:278688 66/170 (39%)
HELICc 1073..1216 CDD:238034 55/144 (38%)
BlmNP_031576.4 BLM_N 4..371 CDD:292819 72/383 (19%)
BDHCT 382..417 CDD:285334 6/35 (17%)
BDHCT_assoc 433..658 CDD:292821 44/254 (17%)
recQ_fam 668..1151 CDD:129701 162/560 (29%)
DEAD 680..852 CDD:278688 66/177 (37%)
HELICc 872..1003 CDD:238034 57/149 (38%)
RecQ_Zn_bind 1008..1077 CDD:292742 15/87 (17%)
RQC 1087..1189 CDD:214936 22/143 (15%)
HRDC 1221..1297 CDD:128635
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.