DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and recql5

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_001135548.1 Gene:recql5 XenbaseID:XB-GENE-958080 Length:1050 Species:Xenopus tropicalis

Alignment Length:468 Identity:152/469 (32%)
Similarity:227/469 (48%) Gaps:97/469 (21%)


  Fly   825 LDTTASSSNRSQHGGVKPLYDLLPDGSVQDTTPEVLEALHMFGHTNFRKG-QDRAIMRTLSGLSS 888
            :.:::|||:.|:           |...:|.|...|      ||..:||.. |:.|....:.|.:.
 Frog     1 MSSSSSSSSSSR-----------PRCRIQTTLKNV------FGFNSFRSDLQENATRAVVKGETD 48

  Fly   889 L-VTLSTGSGKSLCYQLPAYLYSRKVGAITLVISPLVSLMEDQVTGVPHF----LRAHCLHTNQT 948
            : |.:.||:||||||||||.|   .|| ||:|||||::|::||   |.|.    ::|..|::...
 Frog    49 VFVVMPTGAGKSLCYQLPAVL---SVG-ITVVISPLIALIQDQ---VDHLVALKIKACSLNSKLP 106

  Fly   949 APQRMKIQQMIAN--GEIDILLVSPEAVVAGERATGFGAILRQL---PPIAFACIDEAHCVSQWS 1008
            .|:|.||.|.:.:  .:|.:|.::||...    :..|..||.||   ..:::..||||||||:|.
 Frog   107 LPERKKIIQDLESEAPQIKLLYITPEMAA----SASFQPILAQLLSRSLLSYLIIDEAHCVSEWG 167

  Fly  1009 HNFRPSYLMICKVLRKNLGVRTVLGLTATATLPTRVSIINHLGISDGERGIISDIPLP---DNLV 1070
            |:|||.||.:.. ||..:.....:.||||||...:..||..|.:    |..:|....|   .||.
 Frog   168 HDFRPDYLRLGS-LRSRIPHTPCVALTATATKQVQDDIIASLKL----RQPVSMFKTPCFRSNLF 227

  Fly  1071 LSVS-KDENRD------AALLQLLNSER----FEPCQSIIIYCTRRDECERIAGFIRTCVQDRRE 1124
            ..|. ||...|      ...|:.|.::.    |..|.  |:||..||.||.:|            
 Frog   228 YDVQLKDLVGDPYGDLKEFCLKALGTKTPQGGFPGCG--IVYCRTRDACEEVA------------ 278

  Fly  1125 PTQDQTKKRKRVNWQAEPYHAGMPASRRRTVQKAFMSNELRIVVATIAFGMGINKPDIRAVIHYN 1189
               .|..:|..:   ::|||||:.|..|.|:|..:|...:.::||||:||||::|.::|.|.|:|
 Frog   279 ---VQLSQRGVL---SKPYHAGLKAGDRVTIQNDWMDGTVPVIVATISFGMGVDKANVRFVAHWN 337

  Fly  1190 MPRNFESYVQEIGRAGRDGLPSHCHLFLDAKGGDQSELRRHVYSNSIDRHVIRKLLQKIFVPCSC 1254
            :.::...|.||.|||||||..:.|.|:               ||.: ||..:..|::|.......
 Frog   338 IAKSLAGYYQESGRAGRDGKQAFCRLY---------------YSRT-DRDQVGFLIRKEIAQAQA 386

  Fly  1255 ---DKEASKRTAL 1264
               |.:||.:..:
 Frog   387 KRGDNKASDKAGM 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 135/379 (36%)
DEAD 872..1039 CDD:278688 70/178 (39%)
HELICc 1073..1216 CDD:238034 53/154 (34%)
recql5NP_001135548.1 DEXDc 25..230 CDD:214692 82/221 (37%)
DEAD 35..202 CDD:278688 70/179 (39%)
HELICc <261..364 CDD:238034 46/123 (37%)
SrmB <265..>357 CDD:223587 43/110 (39%)
RecQ_Zn_bind 369..437 CDD:292742 7/32 (22%)
RecQ5 646..790 CDD:284397
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.