DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and blm

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:XP_012813863.1 Gene:blm XenbaseID:XB-GENE-982561 Length:1365 Species:Xenopus tropicalis

Alignment Length:1211 Identity:283/1212 (23%)
Similarity:459/1212 (38%) Gaps:318/1212 (26%)


  Fly   208 KLFQSSRGFA-KRNPRKPLS-------RCVSSSSSTTSLSSVPTDHHEELLDFETILIRKAQEYK 264
            :|| |::|.| |.:.:||.|       :|..:.|.:|....|..:           :..|.:...
 Frog    14 ELF-SAKGTANKLSLQKPKSSVFTFKKKCSPNGSLSTGFVEVKQN-----------VALKDKNVN 66

  Fly   265 EKQQAIANN----PMLASEHSKESIKTLVDDGWLRRNTKENTLDEEV---------------PFA 310
            .||..:..|    |..|..:......|.|       .||...|.:.|               |..
 Frog    67 VKQNDVQTNLTVLPKSAERNKINGFFTPV-------YTKSTQLPQTVAVKDHVHINDSANKHPRV 124

  Fly   311 EANNNSGTSKKTNFG-LANL----DLSKLKPTVKEEKVLQAKPDQMAIIQELQTDMNSSMNQKPD 370
            |.:.:..|...|:|| :.:|    ||.....:|...|....|                 :...|.
 Frog   125 EDSASKKTGINTSFGSVTSLEEWDDLDDFDTSVSPPKSQAGK-----------------IKITPQ 172

  Fly   371 HLNHTPPASSQ-KSVAPKNKPPPSEQETDSDSDSVVAESEEEQEPQEYRQL-SKRRKIVSTASGK 433
            :..:|.|.||: :.::||.  |..|::..:            ::|.|..:: |:.:|:|...:.:
 Frog   173 NCKNTSPVSSKIQCLSPKG--PTIEKQMCA------------KKPYENNEIASEPQKLVHAQTAE 223

  Fly   434 VE-----VAAPVEIPNKVEPETETFAQENPDFSADEDQDATYVPENKKKDKAKRKQAAGKQKTTK 493
            :.     ....||..|....|.:|.  .|.|:|..:|                            
 Frog   224 MPDKSLVCLGSVEHTNLGSAEKDTC--RNIDYSGTDD---------------------------- 258

  Fly   494 PKAEPKPKTEKKAKVKAEKKPKAEKKPRNSKKAIAVEPAPDPEEDERQPLNPEDLKYVLALEAGD 558
              .|...:|..:|.::.|...:.:..|          |:|..|.....|:    |:.:.|.....
 Frog   259 --IEHDQETLSQALIENEDDCEPDFIP----------PSPSDESLSSPPV----LRVIGAQRKHK 307

  Fly   559 ITSVPRINVQDLEE-ADATAQRYIRTFAAGPNPGLSEGSNIRVDEKRAAARKKLEERIAAGKLNE 622
            ::||..:|  |.|. ||....:.:.:......|.......:.:.:        |.::|...:|:.
 Frog   308 VSSVTDVN--DCENTADHLQSQCVSSSLDSKVPSHLLSVMLEICD--------LVDKIPISELHV 362

  Fly   623 NFVTINIQKKKFVRGKKSVNFSKYKKQQWRHKKRVAALSGPDMDM-----------GGCDGGVLT 676
            ....::::||:.:|.:..:|.|..:... .....|:..|.|..:|           ......|..
 Frog   363 LSCGMDLKKKRDMRKRLLLNNSVLRSSP-ADSSTVSLTSCPSQNMEFDVSAPKDSENFSGSSVNK 426

  Fly   677 CFQCGGVGHFAQQCKVKGDSLLPLSAQLEEDPSPF-PTLAEAQEMASQGAVVAHSRNISRLPQAA 740
            .|:...:  .|.:...||:          :..|.| |...|..|..:..::.|...::.....:.
 Frog   427 IFKFNKL--VADEFGTKGN----------DRASDFAPNFREKMENKTSFSLQAGGDSVMEDSFSF 479

  Fly   741 NAAILQGDELNESEEDDQESSG----------DEEVQQHPDPNWSSDEMDV-DFEALDAAVEASL 794
            .:.:|...:.|..:.:...||.          |:  ..:||.::..|..|: ||:  |..:::..
 Frog   480 QSNVLSTSQFNTPQNEKPVSSSTCARPISQPIDD--MDNPDLDFDIDNFDIEDFD--DQLMDSPA 540

  Fly   795 SQPVSQEKA---ASPIKTYVGHKIPEEFLKQAGLDTTASSSNRSQHGGVKPLYDLLPDGSVQDTT 856
            :.|||.:.|   .:..:|.......|:..:....|.|.:..:.|.   :||          |...
 Frog   541 APPVSSKNAPQYPTICETQFDSGSKEKVTRHNVGDKTNTELSDSL---LKP----------QIVN 592

  Fly   857 P--------------EVLEALH-MFGHTNFRKGQDRAIMRTLSGLSSLVTLSTGSGKSLCYQLPA 906
            |              |:::..| .||...||..|..||...|.|....:.:.||.|||||||||.
 Frog   593 PALERFKSFNFPHSKEMMKIFHKKFGLHRFRTNQLEAINACLLGEDCFILMPTGGGKSLCYQLPG 657

  Fly   907 YLYSRKVGAITLVISPLVSLMEDQVTGVPHF-LRAHCLHTNQTAPQRMKIQQMIANGE--IDILL 968
            .:..    .:|:|||||.||:.|||..:... :.|..|..::|..:...|...::..:  |.:|.
 Frog   658 CVSP----GVTIVISPLRSLIVDQVQKLTSLDIPATYLTGDKTDAEAASIYLQLSKKDPIIKLLY 718

  Fly   969 VSPEAVVAGER--ATGFGAILRQLPPIAFACIDEAHCVSQWSHNFRPSYLMICKVLRKNLGVRTV 1031
            |:||.|.|..|  :|......|||  :|...||||||||||.|:|||.|..: .:||:......:
 Frog   719 VTPEKVCASTRLISTMENLYERQL--LARFVIDEAHCVSQWGHDFRPDYKRL-NMLRQKFQSVPM 780

  Fly  1032 LGLTATATLPTRVSIINHLGISDGERGIISDIPLPDNLVLSVSKDENRDAALLQLLNSERFEPCQ 1096
            :.|||||....:..|:|.|.::..:  |.:.....|||...|...:.:..||..:...:::.|..
 Frog   781 MALTATANPRVQKDILNQLKMTKPQ--IFTMSFNRDNLKYDVLPKKPKRVALDCVEWIKKYHPND 843

  Fly  1097 SIIIYCTRRDECERIAGFIRTCVQDRREPTQDQTKKRKRVNWQAEPYHAGMPASRRRTVQKAFMS 1161
            |.||||..|.||:.:|..:                  ::....|..||||:..|.|..||..:::
 Frog   844 SGIIYCLSRHECDTMADTL------------------QKGGLAALAYHAGLADSNRDYVQHKWIN 890

  Fly  1162 -NELRIVVATIAFGMGINKPDIRAVIHYNMPRNFESYVQEIGRAGRDGLPSHCHLFLDAKGGDQS 1225
             ::.:::.|||||||||:|||:|.|||.::|::.|.|.||.|||||||..|||.||         
 Frog   891 QDDCQVICATIAFGMGIDKPDVRYVIHASLPKSVEGYYQESGRAGRDGEISHCLLF--------- 946

  Fly  1226 ELRRHVYSNSIDRHVIRKLLQKIFVPCSCDKEASKRTALPIPLEGDG-------------PRVHM 1277
                  ||.| |...||:|:|                     :|.||             ..||.
 Frog   947 ------YSYS-DVTRIRRLIQ---------------------MEKDGNSHTKQTHFNNLYSMVHY 983

  Fly  1278 CPGHEIGFSVEKTVEMLDIPAENISTLLCYM---ELDPRWC 1315
            |         |..||...:      .||.|.   ..:|.:|
 Frog   984 C---------ENVVECRRM------QLLAYFGENNFNPNFC 1009

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 133/361 (37%)
DEAD 872..1039 CDD:278688 67/172 (39%)
HELICc 1073..1216 CDD:238034 54/144 (38%)
blmXP_012813863.1 BLM_N 1..293 CDD:292819 68/371 (18%)
BDHCT 341..378 CDD:285334 6/45 (13%)
recQ_fam 611..1094 CDD:129701 155/479 (32%)
DEAD 623..795 CDD:278688 67/179 (37%)
HELICc 815..946 CDD:238034 56/149 (38%)
RecQ_Zn_bind 951..1020 CDD:292742 19/96 (20%)
RQC 1030..1132 CDD:214936
HRDC 1165..1243 CDD:128635
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.