DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c11.1 and Mroh8

DIOPT Version :8

Sequence 1:NP_001285050.1 Gene:c11.1 / 53436 FlyBaseID:FBgn0040236 Length:1742 Species:Drosophila melanogaster
Sequence 2:XP_017174647.1 Gene:Mroh8 / 629499 MGIID:3603828 Length:1100 Species:Mus musculus

Alignment Length:1056 Identity:207/1057 (20%)
Similarity:403/1057 (38%) Gaps:223/1057 (21%)


  Fly   779 TELAQVGGRKHSTGF-------------------FSNLHFIKDTHKELENYKSNLLVVKAFG--- 821
            |.||::|.|:.::|.                   .|||..::.....:|...|::..:....   
Mouse   141 TPLARMGSRQRASGTEEVVIPCASDSDSGSVDLQLSNLDDVQKGGASVEFTDSDIADIPTLPQES 205

  Fly   822 -----RIMDEADPLQSIQHLDEDDTLLGFLIQ--QLAVH---KDQTIMSAILQTLLSICNQLIAT 876
                 |::...:||        .:|.:..|:|  |..:|   |.:|.....|::|.|: :|.|..
Mouse   206 LPDNLRLLTLQEPL--------SETSIERLVQSIQEVLHGELKGETQKLKFLRSLSSL-SQTIPY 261

  Fly   877 KEQLPAPL-RHRKQIMETVFNIPIEAPFHDL------PLLPTILKLGTD--FIRIGGPDTEECVD 932
            .|...:.: ||..:|:..:..:..|.|.|.|      .:..||..|...  ::..|..|.|:.: 
Mouse   262 DENTESFIHRHTAEIVHVLSVLVQEEPLHSLTSMVRQEIFVTITDLSFQNVYLLFGSEDREDLL- 325

  Fly   933 GGVIFE--IACRNFFGCAQQLKMKFDSQEEDE---RNSFLAKHLNESLPQLNALVRAIVELDASP 992
             |:|.:  |:........|.||:..:...|.|   |.:|.|         .:.:::::|..|...
Mouse   326 -GLITKSIISLPATSTPIQLLKIVSNQAIEQECLYRETFEA---------FSVMLQSLVIKDPHL 380

  Fly   993 ATLDLIIGILEGWTRDRNSEVRICASHVFNNTLDVYIKSMKIGCEAPSKFNQTGQMLGKIVPRCI 1057
            ...|.|...::.|.:......|..|:.|....|...  |..:..:.|.:|.:.|.::..:...|.
Mouse   381 EFFDSIFKHIDPWLQSDRDHERERATTVMAQVLKCL--SSYLSLKLPLQFQRLGNLVAVMALLCG 443

  Fly  1058 DSNGTVRQVSVE----ILQKTLEIACIYETLTIASIDSTADWLKEIETIKEHIITDEP---KQIY 1115
            |....|.:.:.|    :|..||.:..|.:     ..|:.:..|:  ||:|:..:..|.   |:.|
Mouse   444 DPQKEVAEEAAEGTHYLLHITLRLKYIMQ-----DRDNNSKNLR--ETLKKCRLLLEQYSLKRFY 501

  Fly  1116 NLAGDIAKIIALRISSFQYLQFCKTLLHSLRD-PEQSSTIGASVVLKFFIQQKGSEL-------- 1171
            .....|.::..:.:.|.:..||..|:|.||:: |...            |||...||        
Mouse   502 CCPYKIVQVFEVFLDSRELGQFIMTILDSLKNLPHPC------------IQQTAGELLITLVKSA 554

  Fly  1172 ---FHAIPDLVRDSLLALRVCEVPRAKSGVLKALVALTKHHPK---LVCAEMLSQPLPYDPNLVE 1230
               |..:|::|......|.:..:...:..::.. |:|....||   :|.:.:|..|:|||.:|.|
Mouse   555 EARFERVPEIVGVICARLSIITLTSVRQQIINT-VSLFVSRPKYTDVVLSHLLCHPVPYDRHLAE 618

  Fly  1231 YWHLVCNDPELTGLTLDNFLQLLSGASLQEGGQDASLSERQKLASGQPFAIFCALHEMLPCKDIK 1295
            .|..:  :.||:..|...:..|.......||      ..::|:|. ...|:..||:|:|....::
Mouse   619 LWRSL--EVELSNTTWVLWRLLRKLQKCHEG------PSQEKMAY-VAVAVTDALYEVLMGNKLR 674

  Fly  1296 GQLETRFADMFCMLLTSLSSYTNLAAPNPINNASLSPNQTQSGKTKFGFVPNKELIKLNPCQIAL 1360
            ......|..:...||..:.....|         ::|.....||......||    :::.|...|:
Mouse   675 AAAFRLFPQLLMTLLIQIHHSIGL---------TMSDVSIPSGLYAEQEVP----MEVTPLCFAI 726

  Fly  1361 ETFQAFLTNLEMEQIASVLTVNTQLASSADW-----HNYIELLTPMAIGLGQQLQLGSPQMRQLV 1420
            :..:..|......|..|:      :..|..|     ..:::.:..:|..|.::..|.:.::..|:
Mouse   727 QATKTLLLRTLCWQEFSI------MEKSGGWTLLKGEGHLQGVFLLANALMERSHLFAYKILYLL 785

  Fly  1421 NSLSKYVASPYDGQRVAAVGIFSRLVPLKPTGELAASI--LLHLGAALSDPNAVVRGLSIQGMGY 1483
            ..|   :....|..::.:.|.|..|:. .|.......:  .:.|.|.|::.:.:.|.|:::|:  
Mouse   786 VPL---INRGNDKHKLTSAGFFVELLK-SPMARRLPKVYSTIRLKAWLNEESKLFRILALRGL-- 844

  Fly  1484 VGQLGEKEAKRYSETA--IGALLKGVDDPVGDCLINIPLESMRGLSGILRALPSERVEPFHVSLA 1546
                  :...|:.|..  |.:||        .|:::...|:            .||:....:.:.
Mouse   845 ------RNLVRHQEMREDIKSLL--------PCILSSLHET------------DERIILLAIQIL 883

  Fly  1547 IRIRPFLGNYAL-EMREAAIQLFGDICEGKHDDGSSSPTSSMEALR--------EQLIANLFPLL 1602
            :::...|.:..| .|.:..:.||||:.:..|....:...:|::|::        :|::.:|.|||
Mouse   884 LQLVRMLDSTTLATMMKTLLSLFGDVRQDVHCFSMTLFGASIKAVKHTEKKSVEDQVLESLVPLL 948

  Fly  1603 LHLSESEVAIASACRGTLQRVCRLLT----------APRVVEMAEQQLGEERGHQLNYSSFVLEF 1657
            |...:....||...|..|....|.|.          .|..::..|.:.||:...::         
Mouse   949 LFSQDENDEIAKESRRVLTLCARFLNWKLPREVYCKDPLYIKPNEVRRGEKSKGKI--------- 1004

  Fly  1658 VKTIALELTDHIQDFIDSCLPQLRSQWPEVRGSAAIVIGILHNFLSERNVQ---TETVASKIAVL 1719
                         |.:|..||..:.....:|.:|.:.:|:|.:::....::   |:.:...:..|
Mouse  1005 -------------DILDQTLPYSKDPKLPIRRTAVLFVGLLSHYVDTSELKRKGTDWIEKDLREL 1056

  Fly  1720 LKDEQALVRMRAATAL 1735
            |:|.:..:|:.|:.||
Mouse  1057 LQDPEPSLRILASQAL 1072



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D19783at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23120
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.