DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c11.1 and Mroh7

DIOPT Version :8

Sequence 1:NP_001285050.1 Gene:c11.1 / 53436 FlyBaseID:FBgn0040236 Length:1742 Species:Drosophila melanogaster
Sequence 2:NP_001119959.1 Gene:Mroh7 / 381538 MGIID:2685873 Length:1279 Species:Mus musculus

Alignment Length:986 Identity:188/987 (19%)
Similarity:363/987 (37%) Gaps:192/987 (19%)


  Fly   800 IKDTHKELENYKSNLLVVKAFGRIMDEADPLQSIQHLDEDDTLLGFLIQQLAVHKDQTIMSAILQ 864
            :|....|..|:.:...:|   ..|:......:.::..:|.:..:..:::|:......:::|...:
Mouse   374 VKVNEAEKRNHDNKAALV---ANIITYQKNQEMVEMKEEKEATVKMMMRQIQEEPLDSLLSPARR 435

  Fly   865 TLLSICNQLIATKEQLPAPLRHRKQIMET----VFNIP-IEAPFHDLPLLPTILKLGTDFIRIGG 924
            ..:.|..||..||..|  .:|.|.:::.|    ||::| ::|                       
Mouse   436 QAMEILAQLSHTKPIL--SVRERVELVNTCVRSVFSLPSVQA----------------------- 475

  Fly   925 PDTEECVDGGVIFEIACRNFFGCAQQLKMKFDSQEEDERNSFLAKHL-NESLPQLNALVRAIVEL 988
                                            .||:||..:.:.:.| .::|..|..|:.|:...
Mouse   476 --------------------------------MQEKDESKAEVIQILYYQTLDSLQKLLNALFIE 508

  Fly   989 DASPATLDLIIGILEGWTRDRNSEVRICASH----VFNNTLDVYIKSMKIGCEAPSKFNQTGQML 1049
            |.:|..|..|:..|..|.....:..|..|.:    |.|:||      :.:.....|.|...|.:|
Mouse   509 DPTPTGLKSILEPLGPWMNSGKAHERARAVNSNVSVLNHTL------VTLPFLISSGFPTLGLLL 567

  Fly  1050 GKIVPRCIDSNGTVRQVSVEILQKTLE-IACIYETLTIASIDSTADWLKEIETIKEHIITDEPKQ 1113
            |:::.|..|.:       .||.::.|: |..:|..|.:.......:     :|.|:.:..:..:.
Mouse   568 GRLLLRIGDPD-------EEIGREALDGITILYTILDLQKRTKNKE-----DTNKKELYENNKRF 620

  Fly  1114 I--YNLAG---DIAKIIALRISSFQYLQFCKTLLHSL------------RDPEQSSTIGASVVLK 1161
            :  ||...   :|.::|| ....|...|..:.||.:.            :|..:...:.:.|:|.
Mouse   621 LGPYNPVSPCQNILRVIA-EFGDFLGPQQVRDLLLAALEGLKGISETQGKDSGEMMQLASEVMLS 684

  Fly  1162 FFIQQKGSELFHAIPDLVRDSLLALRVCEVPRAKSGVLKALVALTKHHPKLVCAEMLSQPLPYDP 1226
            ..::.........||::::...:.|...:.|||:...|..:..|.......|...:|..|||.|.
Mouse   685 SVLEWYRHRALEVIPEIMQGIYMQLTHIQEPRAREVALLPISFLASSFMTEVVVALLMCPLPLDS 749

  Fly  1227 NLVEYW-HLVCNDPELTGLTLDNFLQLLSGASLQEGGQDASLSERQKLASGQ----PFAIFCALH 1286
            |..|.| .|:...|   ...:.:.|.||.          .||.|:.....|:    |.|....|.
Mouse   750 NGAEMWRQLILRKP---SCDVRDLLDLLL----------TSLKEKPVTKKGRASIVPLAAASGLC 801

  Fly  1287 EMLPCKDIKGQLETRFADMFCMLLTSLSSYTNLAAPNPINNASLSPNQTQSGKTKFGFVPNKELI 1351
            |:|......|::...:..:...||..:..:..|..|:.:.....|.:.||...    |:|.:.::
Mouse   802 ELLSVNSCVGRVRRIYPQLLLALLIQVHYHIGLNLPSRMAPRKDSKDDTQPPL----FIPVRWMV 862

  Fly  1352 KLNPCQIALETF---------QAFLTNLEMEQIASVLTVNTQLASSADWH-NYIELLTPMAIGLG 1406
            |:      ::|.         .|||.    ||      ...:|...|:.| ..:.||....:...
Mouse   863 KV------VKTLLLKMGCSYESAFLE----EQ------GGWELMGQAESHYRGVSLLARAMVHYS 911

  Fly  1407 QQLQLGSPQMRQLVNSLSKYVASPYDGQRVAAVGIFSRLVPLKPTGELAASILL-HLGAALSDPN 1470
            .|      ::.:::..|...:....:..::.|...|..|..::....:.....| .:...||..:
Mouse   912 CQ------ELCRILYLLIPLLERGDERHKITATAFFVELFRMEQVRRIPEEYSLGRMVEGLSHRD 970

  Fly  1471 AVVRGLSIQGMGYVGQLGEKEAKRYSETAIGALLKGVDDPVGDCLINIPLESMRGLSGILRALPS 1535
            .::..|||:|:..:....||.||  .::.:.:::|.:.:..|..::....:..|...|..:.|..
Mouse   971 PIMNVLSIRGLVILACKSEKMAK--VQSLLPSMVKSLKNMDGMLVVEAVHDLKRIFKGQGKKLTD 1033

  Fly  1536 ERVEPFHVSLAIRIRPFLGNYALEMREAAIQLFGDICEGKHDDGSSSPTSSMEALREQLIANLFP 1600
            ..|   :|.:...:.|...:....:|.:.|.::|.:.:       ...|...:|:.|||.:.|.|
Mouse  1034 SAV---YVEMLQILLPHFTDAREMVRASCINVYGKVVK-------KLQTPRTQAMEEQLTSTLMP 1088

  Fly  1601 LLLHLSESEVAIASACRGTLQRVCRLLTAPRVVEMAEQQLGEERGHQL---NYSSFVLEFVKTIA 1662
            ||..:.|....::..|..||  ||       .......:|.::...|.   |....|.:..|.:.
Mouse  1089 LLFIIQEGNAKVSQKCVKTL--VC-------CSSFMNWELPKKAYSQKPWDNQQLTVTKICKYLV 1144

  Fly  1663 LELTDHIQDFIDSCLPQLRSQWPEVRGSAAIVIGIL----HNFLSERNVQTETVASKIAVLLKDE 1723
            ....|::..|::..|...::....:|.|:.|.||.|    .|.::|..:  ..|.:.:.:|..|.
Mouse  1145 SSHRDNVFTFLNQSLEYAKNSRASLRKSSVIFIGSLVPCMENMMTEERL--NEVKATLEILRHDP 1207

  Fly  1724 QALVRMRAATA 1734
            :|.|.:.||.|
Mouse  1208 EASVCICAAQA 1218

Known Domains:


GeneSequenceDomainRegion External IDIdentity
c11.1NP_001285050.1 None
Mroh7NP_001119959.1 Chon_Sulph_att 32..>168 CDD:284079
HEAT 1 913..950 5/43 (12%)
HEAT 2 992..1029 6/39 (15%)
HEAT 3 1035..1072 6/47 (13%)
HEAT 4 1080..1117 13/46 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D19783at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23120
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.