DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c11.1 and hpo-27

DIOPT Version :8

Sequence 1:NP_001285050.1 Gene:c11.1 / 53436 FlyBaseID:FBgn0040236 Length:1742 Species:Drosophila melanogaster
Sequence 2:NP_001263449.1 Gene:hpo-27 / 24104280 WormBaseID:WBGene00016418 Length:1768 Species:Caenorhabditis elegans

Alignment Length:1886 Identity:427/1887 (23%)
Similarity:796/1887 (42%) Gaps:318/1887 (17%)


  Fly    42 AAPNDKPTILEGVLHNIFDGLMD------KEEQVRIAMQQAIVKILETHPERAAEILSEHRSQQP 100
            ||.:...::|:.::     .|:|      .:|.|:..:.:::..|....|........::..|.|
 Worm     2 AATSQVSSLLDLIM-----SLLDTATTYQHQESVKNEVAESLKTIGSHQPNVLLTACHQYLLQNP 61

  Fly   101 KM-------TDQTVAMLLD-CIRRVVGAETPLPPAANQKLIDLALQELTKNPEHLPLIQNPAQRI 157
            |:       ..||:::.:| |  .||   :.|.......:|:||.||:....:........:..:
 Worm    62 KLGAFKRAFVLQTISICVDNC--EVV---SKLDEQIIMLIINLATQEMNMTKDTDVEWAESSMEV 121

  Fly   158 LVAIGRSSPESCEQVMEALQEK---GTSTEGVAHFMLMQCLGLLATENPAGVVPHIKAILSRSQP 219
            ||.:.::: .....|::|:.:|   |.:|.  .|..::..:..:|..||.|:||.:..||||:.|
 Worm   122 LVTLAKNT-RFVSHVIDAILQKFPPGQTTS--PHRYIVLTMATIAVHNPFGLVPFLTDILSRTVP 183

  Fly   220 HLVGIRQDHIKQAHAYAIGRFSEALLE---ESGKKEEE--------------NC---------ST 258
            .|..::.|.::.|.|.||..|.||:.|   |..|:..|              :|         |.
 Worm   184 LLQHVKTDPLRCAWARAICSFCEAVRECETERPKEASEEYIGDHSRPNSASGHCQEVSNRATYSD 248

  Fly   259 EISVAYDVLFNQWLHSREPKVCVEILQALSSMYPLLPKDRIQDQAARLVPQILALYRRSV-DRNA 322
            :....|||:|: |::|::||...|..:.:..:..::.:.|:.:...::|..::.|||:|. :.:.
 Worm   249 QTEAVYDVIFS-WIYSKDPKTRGEAAECVGELCLMIKQTRLVEDVKKIVTNMIPLYRKSYNESHM 312

  Fly   323 VTQFLCSVLKTNLALNATVLDGIIDVLVTHLFDLVCVYPDYE----KPQTVKGHYEVLRCFHLLA 383
            :||.:|..|:.........|:..::.::..||...|:.||..    ..|.:|.|.|..|||.:.|
 Worm   313 ITQGICRFLEAACVDETCPLEPYLEDILNALFPNACLDPDDTTVTLSTQAIKNHSEAFRCFDVAA 377

  Fly   384 GHQPYSTRIMDTLLIHLRNNSERERMKSLLILTHLLNSCAGNIENRIPATIECLKQLILSER--G 446
            ..  ::.||:..||..::|.::.:::.::.:|.||||:...::|::.......||:|:.:|.  .
 Worm   378 TR--FADRIVYYLLHKMQNVADSQKLGAINVLRHLLNATGQHMEDKRSLLTMGLKKLLAAENTTS 440

  Fly   447 IKMKLTLLKTIVALAQKSHIRDKE----FVWFVVRHSCRFSKPSQEHGSQEEHAN------LVLS 501
            |::|..:::..||||..|:: |.|    .:.|:||:  ......||..:::...:      |...
 Worm   441 IRVKRAIVQLCVALADHSYV-DAEGGDYVIAFLVRN--LVGPTEQESAAKKVEVDVAGLNQLRTQ 502

  Fly   502 CENTLYMLASTVGTLDELLKRELLNYLILLDYTDICGNLAKCLASLFAKSPHIEYDIAGD--DAA 564
            |...||.:|:|.....:||...||.::....||.:.|:|.|||.:|.::  .:|   ||.  |..
 Worm   503 CAQALYTIANTCVCATKLLWPYLLEFICCERYTPVVGDLCKCLRTLVSR--EVE---AGRKMDYV 562

  Fly   565 TEQATPESMGAAGEDRSVIKRGKVMVPGAETIYAR-----CLALLGNQQCIKRCSNILSFLRYYH 624
            |....|:                  |.|...::||     |.|.| |....:|.......::...
 Worm   563 TGFDNPK------------------VAGRHAVFARLFTSFCNAPL-NGLLTRRAREAGGLIQAVA 608

  Fly   625 PQVNPALE---ELWERKIPDLLLQINR-----ESAYRQL-------LHDFVLETNEFLGGL---- 670
            |..:|::|   ..|..|:..||.:::.     :||..:|       .|:..|   ::|...    
 Worm   609 PWFHPSMEGPAARWSEKLEPLLDELSTTVSSGDSAPAELRGRKIARWHEACL---DWLSACVAVV 670

  Fly   671 -DENFAQRLASKLADQMYLYPMQLPHSEWHLPDLSAERGMLLQAVALTLLQVTDVACIHTKIDLI 734
             :.::.|.||:.:..|:.:|           .:||.|:..||:.:.:||.::             
 Worm   671 PEGDWRQDLAAAMGKQLDMY-----------KELSDEKSFLLRCLGVTLARI------------- 711

  Fly   735 VTTARQERLD------KHVKHADYEKRIEPCARALGYISRQHLGHLIKKLTELAQVGGRKHSTGF 793
              ||:|..:|      |...|:...:| :.|||.:|.|:..|:..::.:|..:::....:.|:|.
 Worm   712 --TAKQFVIDHMMLMFKSASHSVLTER-QGCARGVGSIATSHMDLILIELENVSKWEHARKSSGI 773

  Fly   794 FSNLHFIKDT-----HKELENYKSNLLVVKAFGRIMDEADPLQSI-QHLDEDDTLLGFLIQQLAV 852
            |.   |||||     :.::|.......::..:|.:: .|..|.:| |.|  .:|::.||....|.
 Worm   774 FG---FIKDTMPIRQYPDIEMIHLRATLMLCYGHVV-MACSLDTITQRL--QNTIIVFLRNYFAN 832

  Fly   853 HKDQTIM-SAILQTLLSIC-----------------NQLIA---------TKEQLPAPLRHRKQI 890
            .|.:|:: .|:|:|:..|.                 |:|:|         |.|.|.:.|| ....
 Worm   833 SKQETVVREAMLETMRLIATAVHPSRIGGEWKFEARNELLAYAKDYLNGETPEWLTSSLR-LLAC 896

  Fly   891 METVFNIPIEAPFHDLPLLPT-ILKLGTDFIRIGGPDTEECVDGGV------IFEIACRNFFGC- 947
            ..|...:.:|.     ||.|. |..:||...|...|...|  ..|:      ||:.|..:.|.. 
 Worm   897 KTTAALVQLEP-----PLSPADIEDIGTVLTRQILPMQRE--KSGLKTLAFDIFDYASSSVFSTF 954

  Fly   948 -----------------------------AQQLKMKFDSQEEDERNSFLAKHLNESLPQLNALVR 983
                                         ..|.......:.||:.::.:   ::.::.|....:.
 Worm   955 SGSSSSHTNIYMTPPLTANSVAEGPNGTPIHQRHRGIGGKMEDDESATI---MDATMHQYGLALE 1016

  Fly   984 AIVELDASPATLDLIIGILEGWTRDRNSEVRICASHVFNNTLDVYIKSMK-IGCEAPSKFNQTGQ 1047
            .||.:..:..|:.:::.||..:...:....||.|..:....|.||.:..: |.....|.|.....
 Worm  1017 QIVRMAPTTQTIMILLKILLPYYGKQADHERIRAVDMTVLVLRVYYECAEDISLGHASDFEPLSS 1081

  Fly  1048 MLGKIVPRCIDSNGTVRQVSVEILQKTLEIACIYETLTIASIDSTADWLKEIETIKEHIITDEPK 1112
            :||::.||.||....||..::..:..||.:|.:::.   ...|:..........:::::.:.:.|
 Worm  1082 LLGRLAPRLIDLLAHVRLQALSAIHWTLRLAYMHKG---HGRDADQSLFSYSGFVEKYLTSGDVK 1143

  Fly  1113 ---QIYNLAGD-IAKIIALRISSFQYLQFCKTLLHSLRDPEQSSTIGASVVLKFFIQQKGSELFH 1173
               |...||.: ||:||..|:...|...:...:...|.|.:...:..|:.:|.:.:..:|:.|..
 Worm  1144 LEGQKEKLAIEAIAQIIEYRLPQSQMQIYLSAIFEMLTDRQSHVSSAAAQLLTYAVMARGATLNA 1208

  Fly  1174 AIPDLVR---DSLLALRVCEVPRAKSGVLKALVALTKHHPKLVCAEMLSQPLPYDPNLVEYWHLV 1235
            ....||.   :.|..:..|  .:..:.||.||||...|..:.||..:..|||||..|:.:.|..:
 Worm  1209 EAEILVTKMVEKLADIHHC--VQTNTDVLAALVAFAVHQQQAVCDVLFKQPLPYSINITDAWECL 1271

  Fly  1236 CNDPELTGLTLDNFLQLLSGASLQE--------GGQDASLSERQKLASGQPFAIFCALHEMLPCK 1292
            ..|..|..:.||:..:|| ||||.:        ||..|      |:.:.:|......|.|::.  
 Worm  1272 SRDKLLFAVILDHLTELL-GASLDQPFELMDSGGGVSA------KVVNVEPCTYVAVLAEVVK-- 1327

  Fly  1293 DIKGQLETRFADMFCMLLTSLSSYTNLAAPNPINNASLSPNQTQSGKTKFGFVPNKELIKLNPCQ 1357
              .|:.|:...:...::||.|..:.     ..:::......|.:..|......|:.......|..
 Worm  1328 --NGEPESALMERLPLILTLLIHFI-----CSVSDTQFPVMQKEGSKNPLIITPDLRRAAEKPAG 1385

  Fly  1358 IALETFQAFLTNLEMEQIASVLTVNTQLASSADWHNYIELLTPMAIGLGQQLQLG-SPQMRQLVN 1421
            :|:...:..|.......:...:..........|..::|:.:|.....|.:|.... ||    |..
 Worm  1386 MAVAAIKNLLNRTRSNMVIEDMNQARAWTDCLDKDSFIQAITVFIRSLVEQRPAWVSP----LAK 1446

  Fly  1422 SLSKYVASPYDGQRVAAVGIFSRLV--PLKPTGELAASILL----HLGAALSDPNAVVRGLSIQG 1480
            ::.:|..|..:.:|:|||.|.:.|:  .....||....:|:    .|..:|:||:..:|.|.::|
 Worm  1447 TMEEYANSESEPRRLAAVIIAASLIRRSTSENGEFNEQLLVKCIRRLEDSLTDPSLRIRKLCVKG 1511

  Fly  1481 MGYVGQLGEKEA-KRYSETAIGALLKGVDDPVGDCLINIPLESMRGLSGILRALPSERVEPFHVS 1544
            :|.:.:....:. .|:...|:.|.:.|:||. ||....:.:||:..|:.:::...:::::.....
 Worm  1512 LGELSECSSTDVISRFVHMAVEAAMSGLDDH-GDRKDTVAIESIMALNKLVQLTNNDQLKSILPL 1575

  Fly  1545 LAIRIRPFLGNYALEMREAAIQLFGDICEGKHDDGSSSPTSSMEALREQLIANLFPLLLHLSESE 1609
            :.::|||.....:..:|.|:..|||::       ||....:| |..|..|..|:..|||||::..
 Worm  1576 VLLKIRPCFEKDSHTLRAASFSLFGEL-------GSRVGENS-EEFRGHLHTNIVSLLLHLNDDF 1632

  Fly  1610 VAIASACRGTLQRVCRLLTAPRVVEMAEQQLGEERGHQ-LNYSSFVLEFVKTIALELTDHIQDFI 1673
            ..:...|..::.|:..|||:|......|::|.:  |.| .:|:.|:.:|...:|....|.|..:.
 Worm  1633 EEVRQNCANSIYRLHGLLTSPNASICIERELKD--GKQPASYNLFIKDFASILANSFPDRINQYA 1695

  Fly  1674 DSCLPQLRSQWPEVRGSAAIVIGILHNFLS---ERNVQTETVASKIAVLLKD-EQALVRMRAATA 1734
            .:.....:|....:|.:||.:.|.|.:.|:   ...:..|.|.:.:..|||| |...||:.|..|
 Worm  1696 LATSNYFKSSSARIRCNAAHLTGCLLDGLTAPLRATISRELVFTGLVALLKDSEDVNVRISATRA 1760

  Fly  1735 L 1735
            :
 Worm  1761 I 1761

Known Domains:


GeneSequenceDomainRegion External IDIdentity
c11.1NP_001285050.1 None
hpo-27NP_001263449.1 HEAT repeat 1447..1470 CDD:293787 7/23 (30%)
HEAT repeat 1482..1517 CDD:293787 9/35 (26%)
HEAT repeat 1530..1562 CDD:293787 10/33 (30%)
HEAT repeat 1571..1601 CDD:293787 8/30 (27%)
HEAT repeat 1614..1646 CDD:293787 10/32 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5113768
eggNOG 1 0.900 E1_KOG2032
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 331 1.000 Inparanoid score I1418
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D19783at33208
OrthoFinder 1 1.000 FOG0002642
OrthoInspector 1 1.000 T475400
orthoMCL 1 0.900 OOG5_132373
Panther 1 1.100 LDO PTHR23120
Phylome 1 0.910 0.957 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5822
TreeFam 1 0.960
1312.800

Return to query results.
Submit another query.