DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c12.1 and Cwc15

DIOPT Version :8

Sequence 1:NP_652605.1 Gene:c12.1 / 53435 FlyBaseID:FBgn0040235 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_075642.1 Gene:Cwc15 / 66070 MGIID:1913320 Length:229 Species:Mus musculus

Alignment Length:263 Identity:144/264 (55%)
Similarity:175/264 (66%) Gaps:38/264 (14%)


  Fly     1 MTTAARPTFDPARGGSGRGEKDLSALSKQYSSRDLPGHTKLKYRETGQGTSDENRNRDFRKELEE 65
            |||||||||:|||||.|:||.|||.|||||||||||.|||:|||:|.|...:|.||||||:||||
Mouse     1 MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEE 65

  Fly    66 REREARSGTGATSSSSGKALPSIVRKAIEANNAGGGSSAAKRSKPDAGQQQAQQAAQQQAANMDA 130
            |||       |.:....:..|:        ......||.:|:.:.|          |..|||:||
Mouse    66 RER-------AAARDKNRDRPT--------REHTTSSSVSKKPRLD----------QIPAANLDA 105

  Fly   131 DEPL-DNDSSDSDSDSDDDD-AALLAELQKIKQERLQETARRESEKKQEDERIRMENILSGNPLM 193
            |:|| |.:..|.:.:||||| |||||||:|||:||.:|.||:|.|:|.|:||||||||||||||:
Mouse   106 DDPLTDEEDEDFEEESDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLL 170

  Fly   194 NYEPGTAASAAGRASGLGGDLKIKRRWDDDVVFKNCARSAPDKK--THFVNDALRSDFHKKFMDK 256
            |....:...|         :.|:||||||||||||||:...|:|  ..||||.|||:||||||:|
Mouse   171 NLTGPSQPQA---------NFKVKRRWDDDVVFKNCAKGIDDQKKDKRFVNDTLRSEFHKKFMEK 226

  Fly   257 YIK 259
            |||
Mouse   227 YIK 229

Known Domains:


GeneSequenceDomainRegion External IDIdentity
c12.1NP_652605.1 Cwf_Cwc_15 1..258 CDD:282713 142/261 (54%)
Cwc15NP_075642.1 Cwf_Cwc_15 1..228 CDD:309839 142/261 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C148118975
eggNOG 1 0.900 E1_KOG3228
Hieranoid 1 1.000
Homologene 1 1.000 H9499
Inparanoid 1 1.050 252 1.000 Inparanoid score I3182
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004528
OrthoInspector 1 1.000 T1083624
orthoMCL 1 0.900 OOG5_128660
Panther 1 1.100 LDO PTHR12718
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R266
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.