DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c12.1 and cwc15

DIOPT Version :8

Sequence 1:NP_652605.1 Gene:c12.1 / 53435 FlyBaseID:FBgn0040235 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001002050.2 Gene:cwc15 / 415140 ZFINID:ZDB-GENE-040625-10 Length:244 Species:Danio rerio

Alignment Length:279 Identity:153/280 (55%)
Similarity:181/280 (65%) Gaps:55/280 (20%)


  Fly     1 MTTAARPTFDPARGGSGRGEKDLSALSKQYSSRDLPGHTKLKYRETGQGTSDENRNRDFRKELEE 65
            |||||||||:|||||.|:||.|||||||||||||||||||:|||:..|...:|.|.||||:||||
Zfish     1 MTTAARPTFEPARGGRGKGEGDLSALSKQYSSRDLPGHTKIKYRQPTQDAPEEVRARDFRRELEE 65

  Fly    66 REREARSG--TGA----TSSSSGKALPSIVRKAIEANNAGGGSSAAKRSKPDAGQQQAQQAAQQQ 124
            |||.|..|  .||    |||||..:                 ||::||.:.|          |..
Zfish    66 RERAAVKGRDRGAREHTTSSSSSSS-----------------SSSSKRPRLD----------QIP 103

  Fly   125 AANMDADEPL--DNDSSDSDSDSDDDDAALLAELQKIKQERLQETARRESEKKQEDERIRMENIL 187
            |||:|||:||  |.|.|.||||||||.|||||||:|||:||.:|..|:|.|:|.|:|||||||||
Zfish   104 AANLDADDPLTDDEDDSGSDSDSDDDTAALLAELEKIKKERAEEQERKEREQKAEEERIRMENIL 168

  Fly   188 SGNPLMNYEPGTAASAAG----------RASGLGGDLKIKRRWDDDVVFKNCARSAPD--KKTHF 240
            |||||:|        .||          :.:.......:||||||||||||||:...:  |:..|
Zfish   169 SGNPLLN--------LAGQQQQQQQQQQQQTQTKNTFSVKRRWDDDVVFKNCAKGVDESRKEKRF 225

  Fly   241 VNDALRSDFHKKFMDKYIK 259
            |||.|||:||||||:||:|
Zfish   226 VNDTLRSEFHKKFMEKYVK 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
c12.1NP_652605.1 Cwf_Cwc_15 1..258 CDD:282713 152/277 (55%)
cwc15NP_001002050.2 Cwf_Cwc_15 1..243 CDD:282713 152/277 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C148119262
eggNOG 1 0.900 E1_KOG3228
Hieranoid 1 1.000
Homologene 1 1.000 H9499
Inparanoid 1 1.050 260 1.000 Inparanoid score I3042
OMA 1 1.010
OrthoDB 1 1.010 D1576404at2759
OrthoFinder 1 1.000 FOG0004528
OrthoInspector 1 1.000 T1052849
orthoMCL 1 0.900 OOG5_128660
Panther 1 1.100 LDO PTHR12718
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R266
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.