DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c12.1 and cwf15

DIOPT Version :8

Sequence 1:NP_652605.1 Gene:c12.1 / 53435 FlyBaseID:FBgn0040235 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_595407.1 Gene:cwf15 / 2540983 PomBaseID:SPBC337.06c Length:265 Species:Schizosaccharomyces pombe

Alignment Length:287 Identity:96/288 (33%)
Similarity:147/288 (51%) Gaps:52/288 (18%)


  Fly     1 MTTAARPTFDPARGGSGRGEKDLSALSKQYSSRDLPGHTKLKYRETGQGTSDENRNRDFRKEL-- 63
            ||||.||.||||||.|.      .|.::..|||.||.|.|||||:..|||.:|.|.:|.|:.|  
pombe     1 MTTAHRPQFDPARGHSE------MAPTRITSSRALPAHLKLKYRQESQGTEEEVRKQDLREALLR 59

  Fly    64 ---------------EEREREARSGTGATSSSSGKA--------LPSIVRKAIEANNAGGGSSAA 105
                           ||..:.::...|.||.|:...        ...::|:.:||:.....|.  
pombe    60 AEAAHFATQEHGASSEEVSQNSKLIEGFTSPSTDDKPNNDVEVDYQELLRQTLEADEDASDSD-- 122

  Fly   106 KRSKPDAGQQQAQQAAQQQAANMDADEPLD---NDSSDSDSDSDDDDAALLAELQKIKQERLQET 167
              ...|:..:.::.:.:::....::.|.:|   ::|||.:|||:|:...||.||:.|||||.:|.
pombe   123 --DSVDSSNKNSEVSIKRRKTESNSQESVDSSNSESSDEESDSEDETQQLLRELENIKQERKREQ 185

  Fly   168 ARRESEKKQEDERIRMENILSGNPLMNYEPGTAASAAGRASGLGGDLKIKRRWDDDVVFKNCARS 232
            ..:|.:.:..::..|...|..||.|:|           :||  .|..::|||||:||||:|..:.
pombe   186 MLQEEKNRALEQEKREREIAFGNELLN-----------KAS--SGSFQVKRRWDEDVVFRNTHKG 237

  Fly   233 APD-KKTHFVNDALRSDFHKKFMDKYI 258
            ..| .:..||||.|||:|||||:.:::
pombe   238 VDDTPRPGFVNDMLRSEFHKKFLARFV 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
c12.1NP_652605.1 Cwf_Cwc_15 1..258 CDD:282713 96/286 (34%)
cwf15NP_595407.1 Cwf_Cwc_15 1..264 CDD:282713 96/286 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I1355
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004528
OrthoInspector 1 1.000 T1124978
orthoMCL 1 0.900 OOG5_128660
Panther 1 1.100 LDO PTHR12718
Phylome 1 0.910 0.952 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R266
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.