DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vhl and AT5G66050

Sequence 1:NP_001260885.1 Gene:Vhl FlyBaseID:FBgn0041174 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_201406.2 Gene:AT5G66050 AraportID:AT5G66050 Length:340 Species:Arabidopsis thaliana

Alignment Length:126 Identity:23/127 (18%)
Similarity:45/127 (35%) Gaps:20/127 (16%)


  Fly    11 DGQQLVGADQGKVEVYVLFANTTYRTLDLYWVCER---ERENMYLTLKPF-------EEVRVNTF 65
            ||..:.|:..|..::..|.|:.......:::...|   .:::|:.|.:|.       .|.||...
plant    67 DGSSISGSGLGDPDLEFLQASVLVAETSMHYKMRRHGFRQDSMWQTSRPLPPFSIRASESRVGVL 131

  Fly    66 TTHSWLFRDYYTGERMHVRSQRIFQPIRVRVPKSQQSPDQLVDVRSEVLIHFPMRSLRENC 126
            .......|.:        :...||  :::........|..:.|...|.|:..|::...|.|
plant   132 PIGLGFLRQF--------KQPTIF--LKISCDGDYLLPVIVGDAAVEKLLDVPLQGHTEEC 182

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VhlNP_001260885.1 pVHL 21..162 CDD:176472 20/117 (17%)
AT5G66050NP_201406.2 DNase-RNase 143..260 CDD:280699 9/43 (21%)
UVR 294..323 CDD:280337
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15160
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.