DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vhl and vhl

DIOPT Version :9

Sequence 1:NP_001260885.1 Gene:Vhl / 53433 FlyBaseID:FBgn0041174 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001074153.1 Gene:vhl / 791202 ZFINID:ZDB-GENE-070112-1042 Length:175 Species:Danio rerio


Alignment Length:139 Identity:40/139 - (28%)
Similarity:74/139 - (53%) Gaps:15/139 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QNNRDGQQ---LVGADQGKVEVYVLFANTTYRTLDLYWVCERERENMYLTLKPFEEVRVNTFTTH 68
            |::::|||   ||.:...:::|.|||.|.:.|.:...|:........|:.::|:...|:.||..|
Zfish     3 QDSQEGQQPLPLVRSLISRIQVNVLFCNCSPRVVKPVWINFLGEPQPYVNIQPYTGRRITTFVGH 67

  Fly    69 SWLFRDYYTGERMHVRSQRIFQPIRVRVPKSQQSPDQLVDVRSEVLIHFPMRSLRENCLWLVARW 133
            .|:|||..|.:.|.|.::.::      :|.|.:: .|:.:.:    |..|:.:||:.||.:|.| 
Zfish    68 PWMFRDAETDDPMVVNNKEMY------LPASLEN-GQVANAK----ITLPVLTLRDRCLQVVRR- 120

  Fly   134 LIRTSNAPR 142
            |:|..:..|
Zfish   121 LVRREDVGR 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhlNP_001260885.1 pVHL 21..162 CDD:176472 34/122 (28%)
vhlNP_001074153.1 VHL 13..157 CDD:280091 36/129 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595948
Domainoid 1 1.000 49 1.000 Domainoid score I11875
eggNOG 1 0.900 - - E1_KOG4710
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5418
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509532at2759
OrthoFinder 1 1.000 - - FOG0005700
OrthoInspector 1 1.000 - - otm25691
orthoMCL 1 0.900 - - OOG6_107013
Panther 1 1.100 - - LDO PTHR15160
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9301
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.