DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vhl and vhl

Sequence 1:NP_001260885.1 Gene:Vhl FlyBaseID:FBgn0041174 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001074153.1 Gene:vhl ZFINID:ZDB-GENE-070112-1042 Length:175 Species:Danio rerio

Alignment Length:139 Identity:40/140 (29%)
Similarity:74/140 (53%) Gaps:15/140 (11%)


  Fly     7 QNNRDGQQ---LVGADQGKVEVYVLFANTTYRTLDLYWVCERERENMYLTLKPFEEVRVNTFTTH 68
            |::::|||   ||.:...:::|.|||.|.:.|.:...|:........|:.::|:...|:.||..|
Zfish     3 QDSQEGQQPLPLVRSLISRIQVNVLFCNCSPRVVKPVWINFLGEPQPYVNIQPYTGRRITTFVGH 67

  Fly    69 SWLFRDYYTGERMHVRSQRIFQPIRVRVPKSQQSPDQLVDVRSEVLIHFPMRSLRENCLWLVARW 133
            .|:|||..|.:.|.|.::.::      :|.|.:: .|:.:.:    |..|:.:||:.||.:|.| 
Zfish    68 PWMFRDAETDDPMVVNNKEMY------LPASLEN-GQVANAK----ITLPVLTLRDRCLQVVRR- 120

  Fly   134 LIRTSNAPR 142
            |:|..:..|
Zfish   121 LVRREDVGR 129

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VhlNP_001260885.1 pVHL 21..162 CDD:176472 34/123 (28%)
vhlNP_001074153.1 VHL 13..157 CDD:280091 36/130 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C189893138
eggNOG 1 0.900 E1_KOG4710
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1509532at2759
OrthoFinder 1 1.000 FOG0004182
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_134630
Panther 1 1.100 LDO PTHR15160
Phylome 1 0.910 0.786 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.