DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vhl and Vhl

Sequence 1:NP_001260885.1 Gene:Vhl FlyBaseID:FBgn0041174 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_033533.1 Gene:Vhl MGIID:103223 Length:181 Species:Mus musculus

Alignment Length:167 Identity:40/168 (24%)
Similarity:65/168 (39%) Gaps:42/168 (25%)


  Fly     8 NNRDGQQLVGADQGKVEVYVLFANTTYRTLDLYWVCERERENMYLTLKPFEEVRVNTFTTHSWLF 72
            |:|:..|            |:|.|.:.|.:...|:........|..|.|....|::::..|.|||
Mouse    33 NSREPSQ------------VIFCNRSPRVVLPLWLNFDGEPQPYPILPPGTGRRIHSYRGHLWLF 85

  Fly    73 RDYYTGERMHVRSQRIFQPIRVRVPKSQQSPDQLVDVRSEVL---IHFPMRSLRENCLWLVARWL 134
            ||..|.:.:.|....:|.|              .::|..:.:   |..|:.:|:|.||.:| |.|
Mouse    86 RDAGTHDGLLVNQTELFVP--------------SLNVDGQPIFANITLPVYTLKERCLQVV-RSL 135

  Fly   135 IRTSNAPRRIIHGYHIPSTLKQQLLSLLTCIESYSRV 171
            ::..|..|..|            :.||...:|.|..|
Mouse   136 VKPENYRRLDI------------VRSLYEDLEDYPSV 160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VhlNP_001260885.1 pVHL 21..162 CDD:176472 34/144 (24%)
VhlNP_033533.1 VHL 27..171 CDD:280091 35/141 (25%)
Interaction with Elongin BC complex. {ECO:0000250} 123..132 0/9 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C189892213
eggNOG 1 0.900 E1_KOG4710
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004182
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_134630
Panther 1 1.100 LDO PTHR15160
Phylome 1 0.910 0.900 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R9301
TreeFam 1 0.960
98.730

Return to query results.
Submit another query.