DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vhl and Vhl

DIOPT Version :10

Sequence 1:NP_524986.1 Gene:Vhl / 53433 FlyBaseID:FBgn0041174 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_033533.1 Gene:Vhl / 22346 MGIID:103223 Length:181 Species:Mus musculus


Alignment Length:167 Identity:40/167 - (23%)
Similarity:65/167 - (38%) Gaps:42/167 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NNRDGQQLVGADQGKVEVYVLFANTTYRTLDLYWVCERERENMYLTLKPFEEVRVNTFTTHSWLF 72
            |:|:..|            |:|.|.:.|.:...|:........|..|.|....|::::..|.|||
Mouse    33 NSREPSQ------------VIFCNRSPRVVLPLWLNFDGEPQPYPILPPGTGRRIHSYRGHLWLF 85

  Fly    73 RDYYTGERMHVRSQRIFQPIRVRVPKSQQSPDQLVDVRSEVL---IHFPMRSLRENCLWLVARWL 134
            ||..|.:.:.|....:|.|              .::|..:.:   |..|:.:|:|.||.:| |.|
Mouse    86 RDAGTHDGLLVNQTELFVP--------------SLNVDGQPIFANITLPVYTLKERCLQVV-RSL 135

  Fly   135 IRTSNAPRRIIHGYHIPSTLKQQLLSLLTCIESYSRV 171
            ::..|..|..|            :.||...:|.|..|
Mouse   136 VKPENYRRLDI------------VRSLYEDLEDYPSV 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhlNP_524986.1 pVHL 21..162 CDD:176472 33/143 (23%)
VhlNP_033533.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
VHL 29..110 CDD:460360 20/76 (26%)
VHL_C 122..170 CDD:407332 12/50 (24%)
Interaction with Elongin BC complex. /evidence=ECO:0000250 123..132 0/8 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.