DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACXA and adcy5

Sequence 1:NP_620475.2 Gene:ACXA FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_001165056.1 Gene:adcy5 ZFINID:ZDB-GENE-081104-470 Length:1186 Species:Danio rerio

Alignment Length:1149 Identity:293/1150 (25%)
Similarity:514/1150 (45%) Gaps:235/1150 (20%)


  Fly    42 LEEEYMKYKIRLMISSLTVFVPMLILLIVAL-----------QVIIWSFTEYTKYIYINAIFDLG 95
            ||..|.:|..||..||||:.:.:|:|:...:           ...:..||              .
Zfish   156 LERLYQRYFFRLNQSSLTMLMAVLVLVCAVMLGFHCAGGMCQLTFVLVFT--------------A 206

  Fly    96 SLILVTGLLSI----NFFEDFVIRHRWVMTFTSTLSAYVV-VLGDIAFNTYYYYKSNWPLNTLYD 155
            :::|:..|:.:    :|.:|    |.|::.:...|....| |:|.:........:..|     :.
Zfish   207 AIVLILTLMVVCNRNSFHQD----HMWIVCYLLILLVLAVQVVGVLFVKPRSASEGIW-----WT 262

  Fly   156 VFVLCMIYMFLPIPSSKAAALLAISVSLTYVIYFIHFMAFNEHNV---AKYVHGLDIVSIDFFHY 217
            ||.:.:||..||: ..:||.:..|.:|..:|:.   ....|:.:|   .:.|..:.|.|..    
Zfish   263 VFFIHVIYTLLPV-RMRAAVITGIILSAIHVLI---SWRLNDMDVFLWKQLVSNVLIFSCS---- 319

  Fly   218 LGFNMMGIFFRIMNDTMVRSSFLDRYQFITEEIWLRQARRQESLLLDSILPPQIAKPIQKSIKEK 282
               |::|:......:...|.:|.:..:.|...:..::..:|:..||.|:||..:|..::..|..|
Zfish   320 ---NIVGVCTHYPAEGSQRQAFQETRECIQARLHSQRENQQQERLLLSVLPRHVALEMKADINAK 381

  Fly   283 IIQPDNDFYHLGTSRTAENFMSIQIHNDVSILYADLVNYTQLTTTLTVEKLVKVLHDLYARFDLA 347
              |.|..|:.:          .||.|::||||:||:..:|.|.:..|.::||..|::|:||||..
Zfish   382 --QEDMMFHKI----------YIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKL 434

  Fly   348 ALSFKVQRIKFLGDCYYCVAGLGESDPDHATMAVSLGISMIANIKEVSVNRSLNIGMRIGVHSGT 412
            |......|||.||||||||:||.|:..|||...|.:|:.||..|..|.....:|:.||:|:|||.
Zfish   435 AAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGR 499

  Fly   413 LFAGVIGKAKLQYDIWGADVNIASRLEATGSPGYVHVSGRTLSSLNAEEYNIYPGTESAQKDPVL 477
            :..||:|..|.|:|:|..||.:|:.:||.|..|.:|::..||:.||. :|::.||: ..:::..|
Zfish   500 VHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLNYLNG-DYDVEPGS-GGERNVYL 562

  Fly   478 QKHPMSTYLLTA-----------IPSLDSDKTISIVEGVP----------------NLDLQTVG- 514
            :||.:.|||:..           |..::..:|.|:.....                :.:::.:| 
Zfish   563 KKHNIETYLIVGCSQKRKEEKAMIAKMNRQRTNSVTHNSTHWTDRPFYNHLNANSVSKEMKRMGF 627

  Fly   515 SNRKSQILKPNLLSHEMREEFRKMPVGGFKFQFPWSRRERNLKNEKVERDLGIFCVAFKDKSVEW 579
            .:.|.:..:.||...:..:||....:.        :|....|::|.|::    |.:.|::..:|.
Zfish   628 EDPKDKNTQENLNPEDEVDEFLGRAID--------ARSIDRLRSEHVKK----FLLTFREPDLEK 680

  Fly   580 NYLHQPDYIFKYSVALGWGIGC--------CLIYIQSVNNSDIFYTGVVINIIAFFVLTFL--LF 634
            .|..|.|..|      |..:.|        |.|.|..|.:|.:.....|:.::...|:.|:  ::
Zfish   681 KYSKQVDSSF------GAYVACASLVFLFICFIQIIIVPHSGLMVGFYVLCLVVLMVVMFISAIY 739

  Fly   635 ICWYKKVCWWHSGQNEHRSYGKLSCAIFHLFEKIQHSFVLRLTVYMMIILCYYMVISLILMSCEK 699
            .|                 :|.....:..|.::|..|.:....|.:..|:..::...:.:.:|..
Zfish   740 SC-----------------FGFFPIPLQTLSKRIVQSRLNSTLVGVFTIVLVFISAFINIFTCST 787

  Fly   700 DQ------YELDIIESKL---------YNYDM----------DPFTCFHPWAYTNMMALILGMSY 739
            |.      .|.:|..|.:         .||.:          .| ||..|..:::.:.|.|....
Zfish   788 DDLKTCLGQEFNISPSNVNACHAHFSSLNYTLWSQNRLCNSSSP-TCNFPEYFSSCVLLSLLACS 851

  Fly   740 TFARIPFALKTFIGCAEAVVFVLVVCFQYAFIFEH-----------------SVTTSPYLKAEIA 787
            .|.::....|.|:.....:::||::......:|::                 .|.|...||  |.
Zfish   852 VFLQVSSIGKLFLMLFIEILYVLIMEVPEVSLFDNVDLLVMANALAPNNGTCIVDTRVPLK--IV 914

  Fly   788 HSCRVCMMLITMYAKERQSEFNTKMNYKLNLDLQNKQKSADVTNQSIIILLNNILPSHVVEVYLS 852
            ....:.:.::.:|...:|.|...::::...|....:::..:........||:||||..|...:|:
Zfish   915 TPVVITVFVLALYLHAQQVESTARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLA 979

  Fly   853 SIAKH-ELYYENYRMVSVMFAMLTNFQ---MDLPS-------LRVLNDIITAFDRLLSAYKQYYV 906
            ...:: ||||::...|:||||.::||.   ::|.:       ||:||:||..||.::|. .|:..
Zfish   980 RERRNDELYYQSCECVAVMFASISNFSEFYVELEANNEGVECLRLLNEIIADFDEIISE-DQFRQ 1043

  Fly   907 VEKIKVVGCTYMAACGLDFSLIENLDSNSNFGSTSLSSELEQVRSRLESSIKEKNHDEVAFIMAT 971
            :||||.:|.|||||.||:.|..:...                 ||.:.:             :|.
Zfish  1044 LEKIKTIGSTYMAASGLNDSTYDKAG-----------------RSHIRA-------------LAD 1078

  Fly   972 FALDLMRVLSVCNKAYAGEPFDRALSTGEIRIGISTGQIMAGVVGASQPHYDIWGNPVNMASRME 1036
            :|:.||..:...|        :.:.:..:::||::.|.::|||:||.:|.||||||.||:||||:
Zfish  1079 YAMRLMDQMKYIN--------EHSFNNFKMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVASRMD 1135

  Fly  1037 STGLSGHIQVTKETAQTLEEFDVMCYYRGLTFVKGRGEIPTYFV 1080
            |||:...||||.:..|.|..::....|||:..|||:||:.|||:
Zfish  1136 STGVPERIQVTTDLYQVLSSYNYTLEYRGVVKVKGKGEMMTYFL 1179

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 58/268 (22%)
CYCc 262..464 CDD:214485 82/202 (41%)
Nucleotidyl_cyc_III 306..489 CDD:299850 78/183 (43%)
CYCc 831..1055 CDD:214485 80/235 (34%)
Nucleotidyl_cyc_III 859..1080 CDD:299850 82/231 (35%)
adcy5NP_001165056.1 AC_N 1..388 CDD:292831 58/268 (22%)
CYCc 354..548 CDD:214485 82/207 (40%)
Guanylate_cyc 390..574 CDD:278633 79/196 (40%)
DUF1053 598..687 CDD:283888 15/101 (15%)
CYCc 961..1155 CDD:214485 80/233 (34%)
Guanylate_cyc 987..1181 CDD:278633 82/233 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.