DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACXA and Adcy2

Sequence 1:NP_620475.2 Gene:ACXA FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_705762.2 Gene:Adcy2 MGIID:99676 Length:1095 Species:Mus musculus

Alignment Length:1215 Identity:317/1216 (26%)
Similarity:525/1216 (43%) Gaps:271/1216 (22%)


  Fly    27 LWEQS-----YLKARCKE-----------LHLEEEYMKYKIRLMISSLTVFVPMLILLIVALQVI 75
            :|:::     ||:.|.:.           |....:::......|.....:.|.:|::::.|...:
Mouse     1 MWQEAMRRRRYLRDRAEAAAAAAAGGGEGLQRSRDWLYESYYCMSQQHPLIVFLLLIVMGACLAL 65

  Fly    76 IWSFTEYTKYIYINAIFDLG--------SLILVTGLLSINFFEDFV------IRHRWVMTFTSTL 126
            :..|            |.||        .||.|...|:| ||..|:      :..:.:..|:..:
Mouse    66 LAVF------------FALGLEVEDHVAFLITVPTALAI-FFAIFILVCIESVFKKLLRVFSLVI 117

  Fly   127 SAYVVVLGDIAFNTYYYYKSNWPLNTLYDVFVLCMIYMFLPI---PSSKAAALLAISVSLTYVIY 188
            ...:|.:|.: |..:....|.|...:.: :|::.::|..||.   .:..|:.|.:.|.::...:|
Mouse   118 WICLVAMGYL-FMCFGGTVSAWDQVSFF-LFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVY 180

  Fly   189 FIHFMAFNEH-------NVAKYVHGLDIVSIDFFHYLGFNMMGIFFRIMNDTMVRSSFLDRYQFI 246
            ........||       ||..::.|              |:.|.:.:.:.:..::.::.|....|
Mouse   181 LSATPGAKEHLFWQILANVIIFICG--------------NLAGAYHKHLMELALQQTYRDTCNCI 231

  Fly   247 TEEIWLRQARRQESLLLDSILPPQIAKPIQKSIKEKIIQPDNDFYHLGTSRTAENFMSIQI--HN 309
            ...|.|...:||:..||.|:||..||..::..|.:::..|     ..|......||.::.:  |.
Mouse   232 KSRIKLEFEKRQQERLLLSLLPAHIAMEMKAEIIQRLQGP-----KAGQMENTNNFHNLYVKRHT 291

  Fly   310 DVSILYADLVNYTQLTTTLTVEKLVKVLHDLYARFDLAALSFKVQRIKFLGDCYYCVAGLGESDP 374
            :|||||||:|.:|:|.:..:..:||.:|::|:.:||..|...:..|||.||||||||:||..|.|
Mouse   292 NVSILYADIVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLP 356

  Fly   375 DHATMAVSLGISMIANIKEVSVNRSLNIGMRIGVHSGTLFAGVIGKAKLQYDIWGADVNIASRLE 439
            :||...|.:|:.|...||:|.....::|.||:|||||.:..||||..|.|||:|..||.:|:.:|
Mouse   357 NHAKNCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHME 421

  Fly   440 ATGSPGYVHVSGRTLSSLNAEEYNIYPGTESAQKDPVLQKHPMSTY--------------LLTAI 490
            |.|.||.||:|..||..||. .|.:..| :...:||.|::|.:.||              |....
Mouse   422 AGGVPGRVHISSVTLEHLNG-AYKVEEG-DGEIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPR 484

  Fly   491 PSLDSDKTISIVE----------------------------GVPNLDLQTVGSNRKSQILKPNLL 527
            .:||..|..:.|.                            .:...|:.....|.:::.|:....
Mouse   485 HTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRTLRTKSQ 549

  Fly   528 SHEMREEFRK---MPVGGFKFQFPWSRRERNLKNEKVERDLGIFCVAFKDKSVEWNYLHQPDYIF 589
            .....||..:   ..:.|...|..|      ||:|.::| :.:|   |.:|::|..|.......|
Mouse   550 KKRFEEELNERMIQAIDGINAQKQW------LKSEDIQR-ISLF---FYNKNIEKEYRATALPAF 604

  Fly   590 KYSVALGWGIGCCLIYIQSVNNSDIFYTGVVI----NII------AFFVLTFLLFIC-------- 636
            ||.|..     .|||::      .||...:::    :|:      ||..|.|:||:|        
Mouse   605 KYYVTC-----ACLIFL------CIFIVQILVLPKTSILGFSFGAAFLSLIFILFVCFAGQLLQC 658

  Fly   637 ---------WYKKVCWWHSGQNEHRSYGKLSCAIFHLFEKIQHSFVLRLTVYMMIILCYYMVISL 692
                     |..|    .||...:|.:.::|..|      :..:.:|.:.|:.|..|        
Mouse   659 SKKASASLLWLLK----SSGIIANRPWPRISLTI------VTTAIILTMAVFNMFFL-------- 705

  Fly   693 ILMSCEKDQYELDIIESKLYNYDM-DPFTC--------FHPW-AYTNMMALILGMSYTFARIPFA 747
                ...::..|....:...|..: |..|.        |.|: .|:.::.||  ....|.|:.:.
Mouse   706 ----SNSEETTLPTANASNANVSVPDNQTAILHARNLFFLPYFIYSCILGLI--SCSVFLRVNYE 764

  Fly   748 LKTFIGCAEAVVFVLVVCFQYAFIFEHSVTTSPYLKA-----------EIAHSCRVCMMLITMYA 801
            ||..|      :.|.:|.:....:..|:.....|.:.           :...|..:.:..||:..
Mouse   765 LKMLI------MMVALVGYNIILLHTHAHVLDAYSQVLFQRPGIWKDLKTMGSVSLSIFFITLLV 823

  Fly   802 KERQSEFNTKMNYKLNLDLQNKQKSADVTNQSIIILLNNILPSHVVEVYLS-SIAKHELYYENYR 865
            ..||||:..::::......:.:::..:.......:||.|:||:||.|.:|: |:...|||:::|.
Mouse   824 LGRQSEYYCRLDFLWKNKFKKEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYD 888

  Fly   866 MVSVMFAMLTNF----------QMDLPSLRVLNDIITAFDRLLSAYKQYYVVEKIKVVGCTYMAA 920
            .|.||||.:.:|          :..|..||:||:||..||.|||..| :..|||||.:|.|||||
Mouse   889 CVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPK-FSGVEKIKTIGSTYMAA 952

  Fly   921 CGLDFSLIENLDSNSNFGSTSLSSELEQVRSRLESSIKEKNHDEVAFIMATFALDLMRVLSVCNK 985
            .|                       |..|.|:..:...|:.:..:. .|..||..|:..|...||
Mouse   953 TG-----------------------LSAVPSQEHAQEPERQYMHIG-TMVEFAYALVGKLDAINK 993

  Fly   986 AYAGEPFDRALSTGEIRIGISTGQIMAGVVGASQPHYDIWGNPVNMASRMESTGLSGHIQVTKET 1050
                    .:.:..::|:||:.|.::|||:||.:|.||||||.||:||||:|||:...||||:||
Mouse   994 --------HSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEET 1050

  Fly  1051 AQTLEEFDVMCYYRGLTFVKGRGEIPTYFVGIDKDLKFMSKKIDR 1095
            :..|:.....|..||:..|||:|::.||||..:     ||:.:.:
Mouse  1051 SLILQTLGYTCTCRGIINVKGKGDLKTYFVNTE-----MSRSLSQ 1090

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 52/273 (19%)
CYCc 262..464 CDD:214485 86/204 (42%)
Nucleotidyl_cyc_III 306..489 CDD:299850 82/199 (41%)
CYCc 831..1055 CDD:214485 88/235 (37%)
Nucleotidyl_cyc_III 859..1080 CDD:299850 87/231 (38%)
Adcy2NP_705762.2 AC_N <37..264 CDD:292831 50/256 (20%)
CYCc 240..443 CDD:214485 87/209 (42%)
Guanylate_cyc 285..469 CDD:278633 81/186 (44%)
DUF1053 499..603 CDD:283888 17/114 (15%)
CYCc 852..1060 CDD:214485 88/241 (37%)
Guanylate_cyc 882..1081 CDD:278633 88/232 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110507430
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D181177at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45627
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.