DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACXA and ADCY5

Sequence 1:NP_620475.2 Gene:ACXA FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:XP_005247134.1 Gene:ADCY5 HGNCID:236 Length:1286 Species:Homo sapiens

Alignment Length:1173 Identity:305/1174 (26%)
Similarity:518/1174 (44%) Gaps:253/1174 (22%)


  Fly    42 LEEEYMKYKIRLMISSLTVFVPMLILLIVALQVIIWSFTEYTKYI-YINAIFDLGSLILVTGLL- 104
            ||..|.:|..||..||||:.  |.:|::|.|.::.:........: |:..:.....:||:..:| 
Human   226 LERLYQRYFFRLNQSSLTML--MAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILIMAVLC 288

  Fly   105 -SINFFEDFVIRHRWVMTFTSTLSAYVV---VLGDIAFNTYYYYKSNWPLNTLYDVFVLCMIYMF 165
             ...|.:|    |..:..:  .|.|.|:   |:|.:........:..|     :.||.:..||..
Human   289 NRAAFHQD----HMGLACY--ALIAVVLAVQVVGLLLPQPRSASEGIW-----WTVFFIYTIYTL 342

  Fly   166 LPIPSSKAAALLAISVSLTYVIYFIHFMAFNEHNVAKYVHGLDIVSIDFFHYLGFNMMGIFFRIM 230
            ||: ..:||.|..:.:|..::...:...|.::..:.:.|..:.|.|..       |::|:.....
Human   343 LPV-RMRAAVLSGVLLSALHLAIALRTNAQDQFLLKQLVSNVLIFSCT-------NIVGVCTHYP 399

  Fly   231 NDTMVRSSFLDRYQFITEEIWLRQARRQESLLLDSILPPQIAKPIQKSIKEKIIQPDNDFYHLGT 295
            .:...|.:|.:..:.|...:..::..:|:..||.|:||..:|..::..|..|  |.|..|:.:  
Human   400 AEVSQRQAFQETRECIQARLHSQRENQQQERLLLSVLPRHVAMEMKADINAK--QEDMMFHKI-- 460

  Fly   296 SRTAENFMSIQIHNDVSILYADLVNYTQLTTTLTVEKLVKVLHDLYARFDLAALSFKVQRIKFLG 360
                    .||.|::||||:||:..:|.|.:..|.::||..|::|:||||..|......|||.||
Human   461 --------YIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILG 517

  Fly   361 DCYYCVAGLGESDPDHATMAVSLGISMIANIKEVSVNRSLNIGMRIGVHSGTLFAGVIGKAKLQY 425
            ||||||:||.|:..|||...|.:|:.||..|..|.....:|:.||:|:|||.:..||:|..|.|:
Human   518 DCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQF 582

  Fly   426 DIWGADVNIASRLEATGSPGYVHVSGRTLSSLNAEEYNIYPGTESAQKDPVLQKHPMSTYLL--- 487
            |:|..||.:|:.:||.|..|.:|::..||:.||. :|.:.||. ..:::..|::|.:.|:|:   
Human   583 DVWSNDVTLANHMEAGGKAGRIHITKATLNYLNG-DYEVEPGC-GGERNAYLKEHSIETFLILRC 645

  Fly   488 --------TAIPSLDSDKTISIVEGVPNLDLQTVGSNRKSQILKPNLLSHEMREEFRKMPVGGFK 544
                    ..|..::..:|.||....|:...:....|.    |..|.:|.||:.         ..
Human   646 TQKRKEEKAMIAKMNRQRTNSIGHNPPHWGAERPFYNH----LGGNQVSKEMKR---------MG 697

  Fly   545 FQFPWSRRERNLKN--EKVERDLG-----------------IFCVAFKDKSVEWNYLHQPDYIFK 590
            |:.|..:..:...|  ::|:..||                 .|.:.|::..:|..|..|.|..| 
Human   698 FEDPKDKNAQESANPEDEVDEFLGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRF- 761

  Fly   591 YSVALGWGIGCC-LIYIQSVNNSDIFYTGVVINII--AFFVLTF------LLFICWYKKVCWWHS 646
                 |..:.|. |::        :|...|.|.|:  :.|:|:|      ||.:..:..|.:   
Human   762 -----GAYVACASLVF--------LFICFVQITIVPHSIFMLSFYLTCSLLLTLVVFVSVIY--- 810

  Fly   647 GQNEHRSYGKLSCA------IFHLFEKIQHS---------FVLRLTVYMMIILCYYMVISLILMS 696
                       ||.      :..|..||..|         |.:.| |::...:..:...|..|:.
Human   811 -----------SCVKLFPSPLQTLSRKIVRSKMNSTLVGVFTITL-VFLAAFVNMFTCNSRDLLG 863

  Fly   697 CEKDQYELD--------IIESKLYNYDM--DPFTCFHPWA-------YTNMMALILGMSYTFARI 744
            |...::.:.        :.||.: ||.:  :...|..||.       :|..:.|.|.....|.:|
Human   864 CLAQEHNISASQVNACHVAESAV-NYSLGDEQGFCGSPWPNCNFPEYFTYSVLLSLLACSVFLQI 927

  Fly   745 PFALKTFIGCAEAVVFVLVVCFQYAFIFEHS---VT----------TSPYLKAE----------- 785
            ....|..:..|..:::||:|......:|:::   ||          ||.:...|           
Human   928 SCIGKLVLMLAIELIYVLIVEVPGVTLFDNADLLVTANAIDFFNNGTSQWSLCENLRHRRMEAGT 992

  Fly   786 ----------IAHSCRVCMMLIT----------MYAKERQSEFNTKMNYKLNLDLQNKQKSADVT 830
                      ..|:.:|.:.::|          :|...:|.|...::::...|....:::..:..
Human   993 YFPSGVKEQSPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWKLQATEEKEEMEEL 1057

  Fly   831 NQSIIILLNNILPSHVVEVYLSSIAKH-ELYYENYRMVSVMFAMLTNFQ---MDLPS-------L 884
            ......||:||||..|...:|:...:: ||||::...|:||||.:.||.   ::|.:       |
Human  1058 QAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECL 1122

  Fly   885 RVLNDIITAFDRLLSAYKQYYVVEKIKVVGCTYMAACGLDFSLIENLDSNSNFGSTSLSSELEQV 949
            |:||:||..||.::|. .::..:||||.:|.|||||.||:.|..:.:      |.|.:.:     
Human  1123 RLLNEIIADFDEIISE-DRFRQLEKIKTIGSTYMAASGLNDSTYDKV------GKTHIKA----- 1175

  Fly   950 RSRLESSIKEKNHDEVAFIMATFALDLMRVLSVCNKAYAGEPFDRALSTGEIRIGISTGQIMAGV 1014
                               :|.||:.||..:...|        :.:.:..:::||::.|.::|||
Human  1176 -------------------LADFAMKLMDQMKYIN--------EHSFNNFQMKIGLNIGPVVAGV 1213

  Fly  1015 VGASQPHYDIWGNPVNMASRMESTGLSGHIQVTKETAQTL--EEFDVMCYYRGLTFVKGRGEIPT 1077
            :||.:|.||||||.||:||||:|||:...||||.:..|.|  ..:.:.|  ||:..|||:||:.|
Human  1214 IGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLEC--RGVVKVKGKGEMMT 1276

  Fly  1078 YFV 1080
            ||:
Human  1277 YFL 1279

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 58/255 (23%)
CYCc 262..464 CDD:214485 82/202 (41%)
Nucleotidyl_cyc_III 306..489 CDD:299850 76/194 (39%)
CYCc 831..1055 CDD:214485 80/237 (34%)
Nucleotidyl_cyc_III 859..1080 CDD:299850 82/233 (35%)
ADCY5XP_005247134.1 AC_N 1..458 CDD:292831 58/255 (23%)
CYCc 424..619 CDD:214485 83/208 (40%)
Guanylate_cyc 460..633 CDD:278633 74/185 (40%)
DUF1053 668..760 CDD:283888 19/105 (18%)
CYCc 1061..1262 CDD:214485 80/240 (33%)
Guanylate_cyc 1087..1281 CDD:278633 82/235 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4862
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.