DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACXA and adcy4

Sequence 1:NP_620475.2 Gene:ACXA FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:XP_002934331.2 Gene:adcy4 XenbaseID:XB-GENE-984909 Length:1072 Species:Xenopus tropicalis

Alignment Length:1180 Identity:327/1181 (28%)
Similarity:530/1181 (45%) Gaps:258/1181 (22%)


  Fly    32 YLKARC-KELHLEEEY----MKYKIRLMISSLTVFVPMLILLIVALQVIIWSFTEYTKYIYINAI 91
            :.:.|| ||..|.|.|    .:|.:.|::        :||:|.|...:||.:|.  |...:.:.:
 Frog    11 HYRQRCEKEGPLYETYYRLTQQYPVILLL--------LLIVLAVCCALIIITFA--TGRTFSDNV 65

  Fly    92 FDLGSLILVTGLLSINFFEDFVIRHRWVMTFTSTLSAYVVVLGDIAFNTYYY-----YKSNWPLN 151
            ..|.:|....|:.||.|..  |...:.|......:.  ||:||.:....|.:     ..|.|. .
 Frog    66 CFLVTLFCALGVFSILFIP--VCIKKVVQKCMQIIG--VVILGCLVTLGYVFIFTSGLVSAWD-Q 125

  Fly   152 TLYDVFVLCMIYMFLPIPSSKAAALLAISVSLTYVI----YFIHFMAFNEHNVAKYVHGLDIVSI 212
            ..:.:||:..:|..||: ..|.|....:|..:.::|    |..........:||     |.::: 
 Frog   126 IYWTLFVIISLYTMLPL-GMKWAIFAGLSCFVAHIIVLSVYVSTVRLLPRDDVA-----LQMIA- 183

  Fly   213 DFFHYLGFNMMGIFFRIMNDTMVRSSFLDRYQFITEEIWLRQARRQESLLLDSILPPQIAKPIQK 277
            |....|..|::|.:.:.:.::.::.::.:...||...:.|....||:..||.||||..||..::.
 Frog   184 DAVILLCGNVIGGYHKCVTESALKDTYHEAINFIHSRLKLVSQERQQERLLLSILPAYIATEMKA 248

  Fly   278 SI----KEKIIQPDNDFYHLGTSRTAENFMSIQI--HNDVSILYADLVNYTQLTTTLTVEKLVKV 336
            .|    |||..||:|          ..||.::.|  |.||||||||:|.:|.|::..:.::||.:
 Frog   249 EIIERLKEKRPQPEN----------TNNFHNLYIKRHKDVSILYADIVGFTLLSSECSPKELVLM 303

  Fly   337 LHDLYARFDLAALSFKVQRIKFLGDCYYCVAGLGESDPDHATMAVSLGISMIANIKEVSVNRSLN 401
            |::|:.:||..|...:..|||.||||||||:||.|..|:||...|.:|:.|...|:::.....::
 Frog   304 LNELFGKFDQIAKDNECMRIKILGDCYYCVSGLPEFLPNHAKNCVLMGLDMCQAIRKLRKATGVD 368

  Fly   402 IGMRIGVHSGTLFAGVIGKAKLQYDIWGADVNIASRLEATGSPGYVHVSGRTLSSLNAEEYNIYP 466
            |.||:|||||.:..||||..|.|||:|..||.:|:.:||.|.||.||::..|||.|. .||.:..
 Frog   369 INMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITEATLSHLE-NEYEVED 432

  Fly   467 GTESAQKDPVLQKHPMSTYLL-----------TAIPSLDSDKTISIVEGVPNLD--------LQT 512
            .| .||:|..|:::.:.|||:           ..:||..::        ||.:.        |::
 Frog   433 AT-LAQRDLYLKENNIKTYLVIDPRANDGEAEDILPSKSAE--------VPKMRASVRMTRYLES 488

  Fly   513 VG--------SNRKSQILKPNLLSHEMREEFRKMPVGGFKFQFPWSR------RERN-------- 555
            .|        |:|.|.:.:|:.:||.|     .:|:.  .....||:      ||.|        
 Frog   489 WGAEKPFAHLSHRDSLVPEPHSISHSM-----DLPMS--PLSQTWSQEKSRSTRETNESLNDNNF 546

  Fly   556 --------LKNEKVERDLGIFCVAFKDKSVEWNYLHQPDYIFKYSVALGWGIGCCLIYIQSVNNS 612
                    .:..|..:|.....:.|.||:.|..|.......|||..|      ||..        
 Frog   547 HIMEVLASQRQWKRSKDFNRITLYFNDKAAEKEYRLSDLPSFKYYTA------CCFF-------- 597

  Fly   613 DIFYTGVVINI--------------IAFFVLTFLLFICWYKKVCWWHSGQNEHRSYGKLSCAI-- 661
             ||....::.|              |:||....|||.|:                .|.|:..|  
 Frog   598 -IFACNFIVQILVSHKNAAFGISYGISFFFFLLLLFTCF----------------AGHLARCILK 645

  Fly   662 ----FHLFEKIQHSFVLRLTVYMMIILCYYMVISLILM-----------SCEKDQYELDIIESKL 711
                .|....:  |..|....::.:.|..:.::::::|           :|.:..:...:     
 Frog   646 GPQLLHWLPSL--SIALSSRPWLRVPLGVFTILTVLVMAVFNLFFLPDNNCPQQSWNSSL----- 703

  Fly   712 YNYDMDPFTCFHPWAYTNMMALILGMSYTFARIPFALKTFIGCAEAVVFVL---VVCFQYAFIFE 773
             :.|.:|...:....|  |...|||:   .|...|.|..|    ||.:.:|   :|.:...|:..
 Frog   704 -SPDPEPQMLYSLPYY--MYCCILGL---LACSAFLLMNF----EAKLILLSIALVIYNVIFLET 758

  Fly   774 HSVTTSPYL--------------KAEIAHSCRVCMMLITMYAKERQSEFNTKMNYKLNLDLQNKQ 824
            ||..:..|:              :.::..|..:.:...|:.|..||:|:..::::......:.::
 Frog   759 HSWLSDCYVNWLYMNHSRPGILKEPKVMGSISLFIFFFTLLALSRQNEYYCRLDFLWKRKFKMER 823

  Fly   825 KSADVTNQSIIILLNNILPSHVVEVYLSSIAKHE-LYYENYRMVSVMFAMLTNFQ---------- 878
            :..:.......:||.|:||:.|.:.::....::| |||::|..|.|:||.:.:|:          
 Frog   824 ERIETMENLNRVLLENVLPADVAQQFIGQNRRNEDLYYQSYDCVCVLFASIPDFKEFYTECDENH 888

  Fly   879 MDLPSLRVLNDIITAFDRLLSAYKQYYVVEKIKVVGCTYMAACGLDFSLIENLDSNSNFGSTSLS 943
            ..|..||:||:||..||.|||..| :..|||||.:|..||||.||          |:..|..:..
 Frog   889 EGLECLRLLNEIIADFDELLSKPK-FSSVEKIKTIGSAYMAATGL----------NATSGQENPQ 942

  Fly   944 SELEQVRSRLESSIKEKNHDEVAFIMATFALDLMRVLSVCNKAYAGEPFDRALSTGEIRIGISTG 1008
            .             .::|::.:. ||..||:.|:..|.:.||        .:.:..::|:||:.|
 Frog   943 D-------------GDRNYNHIG-IMVEFAIALIGKLDLINK--------HSFNNFKLRVGINHG 985

  Fly  1009 QIMAGVVGASQPHYDIWGNPVNMASRMESTGLSGHIQVTKETAQTLEEFDVMCYYRGLTFVKGRG 1073
            .::|||:||.:|.||||||.||:||||:|||:.|.||||:||.:.||:....|..||:..|||:|
 Frog   986 PVVAGVIGAQKPQYDIWGNTVNVASRMDSTGVLGKIQVTEETTKVLEKLGYKCERRGVIKVKGKG 1050

  Fly  1074 EIPTYFVGID 1083
            ::.||||..|
 Frog  1051 QLCTYFVSTD 1060

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 65/266 (24%)
CYCc 262..464 CDD:214485 91/208 (44%)
Nucleotidyl_cyc_III 306..489 CDD:299850 82/196 (42%)
CYCc 831..1055 CDD:214485 85/235 (36%)
Nucleotidyl_cyc_III 859..1080 CDD:299850 89/231 (39%)
adcy4XP_002934331.2 AC_N <17..250 CDD:292831 60/255 (24%)
CYCc 227..429 CDD:214485 93/213 (44%)
Guanylate_cyc 270..453 CDD:278633 82/185 (44%)
DUF1053 483..586 CDD:283888 22/110 (20%)
CYCc 821..1036 CDD:214485 86/248 (35%)
Guanylate_cyc 859..1057 CDD:278633 89/231 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110236367
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D181177at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.800

Return to query results.
Submit another query.