DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACXA and dnajc27

Sequence 1:NP_620475.2 Gene:ACXA FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_001096154.1 Gene:dnajc27 XenbaseID:XB-GENE-490420 Length:1116 Species:Xenopus tropicalis

Alignment Length:1203 Identity:309/1204 (26%)
Similarity:532/1204 (44%) Gaps:287/1204 (24%)


  Fly    42 LEEEYMKYKIR-----LMISSLTVFVPMLILLIVALQVIIWSFTEYTKYIYINAIFDLGSLILVT 101
            ||..|..|..|     |::  |.||..:....::.:..:::|..:....: :..:..|..|:|..
 Frog    62 LENLYQTYFRRQRHETLLV--LVVFAALFDCYVIVMCAVVYSNDKLASTL-VAVVGLLAHLLLFV 123

  Fly   102 ----GLLSINFFEDFVIRHRWVMTFTSTLSAYVVVLGDIAFNTYYYYKSNWPLNTL-YDVFVLCM 161
                |||.......||....|:: ..:.:.:|      :..|..::::::   :|: :..|.:..
 Frog   124 LCKFGLLPDRISRKFVPYILWIL-IAAQIFSY------LGLNFAHFHEAS---DTVGWQAFFVFS 178

  Fly   162 IYMFLPIPSSKAAALLAISVSLTYVIYFIHFM-----AFNEHNVAKYVHGLDIVSIDFFHYLGFN 221
            .::.||:..:....:.|:|..:..::..:...     :.|.:.:.:.:  |..|:|    ||...
 Frog   179 FFITLPLRLTPIVLITAVSCGIHTLVLGVTIAQQQQDSINGNALLRQI--LSNVAI----YLCTI 237

  Fly   222 MMGIFFRIMNDTMVRSSFLDRYQFITEEIWLRQARRQESLLLDSILPPQIA----KPIQKSIKEK 282
            .:||....|.|...|.:||:..|.:..::.|.:..:|:..||.||||..||    |.::|..|:|
 Frog   238 TVGIMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLKDMKKDQKQK 302

  Fly   283 IIQPDNDFYHLGTSRTAENFMSIQIHNDVSILYADLVNYTQLTTTLTVEKLVKVLHDLYARFDLA 347
            .:|..|..|             :..|.:||||:||:|.:|||::..:.::|||:|::|:||||..
 Frog   303 ELQQFNTMY-------------MYRHENVSILFADIVGFTQLSSYCSAQELVKLLNELFARFDKL 354

  Fly   348 ALSFKVQRIKFLGDCYYCVAGLGESDPDHATMAVSLGISMIANIKEVSVNRSLNIGMRIGVHSGT 412
            |......|||.|||||||:.||.:...|||..::.:|::|:..|..|......::.||:||||||
 Frog   355 AAKNHQLRIKILGDCYYCICGLPDYREDHAACSIMMGLAMVDAISYVREKTKTDVDMRVGVHSGT 419

  Fly   413 LFAGVIGKAKLQYDIWGADVNIASRLEATGSPGYVHVSGRTLSSLNAEEYNIYPGTESAQKDPVL 477
            :..||:|:.:.|||:|..||.:|:::||.|.||.||:|..|...|.. |:.:.|| |...:...|
 Frog   420 VIGGVLGQKRWQYDVWSTDVTLANKMEAGGIPGRVHISQSTYDCLKG-EFEVEPG-EGGTRCDYL 482

  Fly   478 QKHPMSTYLLTAIPSLDSDKTISIVEGVPNLDLQTVGSNRKSQILKPNLLSHE-----------M 531
            ::..:.|||: .:|....:|     .|:..:.|....|:..|    |.|::.:           .
 Frog   483 REKGIVTYLV-IVPKQPINK-----NGINGVKLSLTSSHGNS----PQLINTKECNGSIHTTCTT 537

  Fly   532 REEFRKMPVGGFKFQFPWSRRERNLKN--EKV------ERDLG-IFCVAFKDKS----VEWNYLH 583
            .:|..::........||..||...|::  |:|      |::|. :...|..::.    ::..|.:
 Frog   538 PDENEELDTRVVNPSFPNPRRRLRLRDLAERVIDAQQNEQELNKLLNEALLERETVQVLKGKYTY 602

  Fly   584 Q-------PDYIFKYSV----ALGWGIGC-CLIYIQSVNNSDIFYTGVVINIIAFF---VLTFLL 633
            :       |:...::||    ..|....| |::.:.:.....:....::.|.:.|.   :|..:|
 Frog   603 RLSMRFINPEMETRFSVEKEKQSGAAFSCSCVVLLFTAIVQILIDPMLIANYVTFVIGEILLLVL 667

  Fly   634 FIC-------------------WYKKVCW------------------------------------ 643
            .||                   |..:..|                                    
 Frog   668 TICSLAAIFPRVFPKKLVAFSTWIDRTRWARNTWAMSAIFILTMADIVDMLSCLQYYGTLNITSP 732

  Fly   644 ----WHSGQN-EHRSYGKLSCAIFHLFEKI---QHSFVLRLTVYMMIILCYYMVISLILMSCEKD 700
                |...:| ::.||    .|:..|...|   |.|.:::||:.:||.:. ..|:::.......|
 Frog   733 AQEAWGCVENPKYYSY----IAVLALIATIMLVQVSHMVKLTLMLMITIA-VGVVNIYAWRPIFD 792

  Fly   701 QYELDIIESKLYNYDMDPFTCFHPWAYTNMMALILGMSYTFARIPFALKTFIGCAEAVVFVLVVC 765
            .|     :||.:|               ..:||::...|:..              |::||:::.
 Frog   793 DY-----DSKRFN---------------GYLALLVPSKYSMT--------------AMIFVMMLS 823

  Fly   766 FQYAFIFEHSVTTSPYLKAEIAHSCRVCMMLITMYAKERQSEFNTKMNYKLNLDLQNKQKSADVT 830
            |.|                               :|:..:....|...:|:::. :.|:|..|:.
 Frog   824 FYY-------------------------------FARHVEKLARTLFLWKIDVH-EQKEKVYDMR 856

  Fly   831 --NQSIIILLNNILPSHVVEVYLSSIAK-HELYYENYRMVSVMFAMLTNF----------QMDLP 882
              |::   |:.|:||.||...:|.|..: .|||.::|..:.||||.:.||          ...:.
 Frog   857 RWNEA---LVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGVMFASIPNFSDFYTEESINNGGIE 918

  Fly   883 SLRVLNDIITAFDRLLSAYKQYYVVEKIKVVGCTYMAACGLDFSLIENLDSNSNFGSTSLSSELE 947
            .||.||:||:.||.||.. .|:..:.|||.:|.|||||.|:      ..|||:|..:.::..|  
 Frog   919 CLRFLNEIISDFDALLDE-PQFRCITKIKTIGSTYMAASGV------TPDSNANGYNNTIKKE-- 974

  Fly   948 QVRSRLESSIKEKNHDEVAFIMATFALDLMRVLSVCNKAYAGEPFDRALSTGEIRIGISTGQIMA 1012
                    .|.:|...:....:|.||| .|:| ::.|..|  :.|:..:    :|||::.|.::|
 Frog   975 --------EISDKERWQHLADLADFAL-AMKV-TLMNINY--QSFNNFM----LRIGLNKGGVLA 1023

  Fly  1013 GVVGASQPHYDIWGNPVNMASRMESTGLSGHIQVTKETAQTLEEFDVMCYYRGLTFVKGRGEIPT 1077
            ||:||.:||||||||.||:||||||||:.|:|||.:||...|:|:......||..:|||:||:.|
 Frog  1024 GVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETHDVLKEYGFRFVRRGPIYVKGKGELLT 1088

  Fly  1078 YFV-GIDKDLKFMSKKIDRLSENPSNPDLNHDL 1109
            :|: |.||...|:         |.|:..|.|.:
 Frog  1089 FFLKGRDKQGSFI---------NGSSVTLPHQV 1112

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 57/268 (21%)
CYCc 262..464 CDD:214485 84/206 (41%)
Nucleotidyl_cyc_III 306..489 CDD:299850 76/183 (42%)
CYCc 831..1055 CDD:214485 90/235 (38%)
Nucleotidyl_cyc_III 859..1080 CDD:299850 90/231 (39%)
dnajc27NP_001096154.1 AC_N <37..291 CDD:292831 51/248 (21%)
CYCc 273..469 CDD:214485 85/210 (40%)
Guanylate_cyc 310..482 CDD:278633 73/187 (39%)
CYCc 854..1073 CDD:214485 92/247 (37%)
Guanylate_cyc 885..1093 CDD:278633 90/233 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.