DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZFYVE1 and CG31064

DIOPT Version :9

Sequence 1:NP_067083.1 Gene:ZFYVE1 / 53349 HGNCID:13180 Length:777 Species:Homo sapiens
Sequence 2:NP_001287560.1 Gene:CG31064 / 43277 FlyBaseID:FBgn0051064 Length:877 Species:Drosophila melanogaster


Alignment Length:110 Identity:42/110 - (38%)
Similarity:55/110 - (50%) Gaps:15/110 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   550 LKDNNNAAQRLLDGMNFMAQSVSELSLGPTKAVTSWLTDQIAPAYWRPNSQILSCNKCATSFKDN 614
            ::|.....::||.|   .|||:..:    .:||.|       |..|.|:|....|..|...|...
  Fly   782 MQDQERRQRQLLSG---SAQSLQAM----PEAVGS-------PGIWAPDSIATHCTACEREFNLT 832

Human   615 DTKHHCRACGEGFCDSCSSKTRP-VPERGWGPAPVRVCDNCYEAR 658
            ..|||||:|||.||.:||..|.| :..:|....|||||||||.|:
  Fly   833 RRKHHCRSCGEIFCKACSEHTLPLLNAQGQPGKPVRVCDNCYAAK 877

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZFYVE1NP_067083.1 GBP 174..410 CDD:206650
Required for localization in the lipid droplets. /evidence=ECO:0000269|PubMed:30970241, ECO:0000269|PubMed:31293035 416..777 42/110 (38%)
FYVE_like_SF 594..655 CDD:333710 28/61 (46%)
FYVE_ZFYV1 711..771 CDD:277273
CG31064NP_001287560.1 RUN 316..439 CDD:280855
CASP_C 495..>634 CDD:285395
FYVE_RUFY1_like 813..874 CDD:277261 28/60 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149908
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.