DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Stx7 and Syx7

Sequence 1:NP_001345492.1 Gene:Stx7 MGIID:1858210 Length:261 Species:Mus musculus
Sequence 2:NP_730632.1 Gene:Syx7 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster

Alignment Length:276 Identity:111/277 (40%)
Similarity:160/277 (58%) Gaps:29/277 (10%)


Mouse     6 GIGG----DSAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKET 66
            |.||    |..:|||.|:::|||:.|....:||.:|||.||||||||::||.|...|||||..:|
  Fly    14 GGGGLSEIDFQRLAQIIATSIQKVQQNVSTMQRMVNQLNTPQDSPELKKQLHQIMTYTNQLVTDT 78

Mouse    67 DKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKAQRQAAEREKEF----------VAR 121
            :..|.|     ....::|..|||:||||.|||.:||.||..||:.|:.||..          :||
  Fly    79 NNQINE-----VDKCKERHLKIQRDRLVDEFTAALTAFQSVQRKTADIEKTALRQARGDSYNIAR 138

Mouse   122 VRASSRVSGGFPEDSSKEKNLVSWE------SQTQPQVQVQDEEITEDDLRLIHERESSIRQLEA 180
            ...||| :|.....:|::.|...:|      ...|.|:|.|.||  :.||:.:.|:|..||:||.
  Fly   139 PPGSSR-TGSSNSSASQQDNNSFFEDNFFNRKSNQQQMQTQMEE--QADLQALEEQEQVIRELEN 200

Mouse   181 DIMDINEIFKDLGMMIHEQGDMIDSIEANVESAEVHVQQANQQLSRAADYQRKSRKTLCIIIFIL 245
            :|:.:|||:|.||.:::|||..:||||:.||...:.|.|..:.|.:|:.|:.|.||...|::.||
  Fly   201 NIVGVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLILVGIL 265

Mouse   246 -VVGIVIICLIVWGLK 260
             .|.:.||.::|:..|
  Fly   266 SAVLLAIILILVFQFK 281

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Stx7NP_001345492.1 Syntaxin_2 18..119 CDD:316990 49/111 (44%)
SNARE_syntaxin7 168..227 CDD:277228 25/59 (42%)
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 49/101 (49%)
COG5325 <97..276 CDD:227635 69/182 (38%)
SNARE 188..247 CDD:304603 25/59 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C66173871
eggNOG 1 0.900 E1_COG5325
Hieranoid 1 1.000
Homologene 1 1.000 H37823
Inparanoid 1 1.050 166 1.000 Inparanoid score I4145
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1204812at2759
OrthoFinder 1 1.000 FOG0000767
OrthoInspector 1 1.000 T616015
orthoMCL 1 0.900 OOG5_128082
Panther 1 1.100 O PTHR19957
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3589
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.