DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLCD1 and sl

DIOPT Version :8

Sequence 1:NP_001124436.1 Gene:PLCD1 / 5333 HGNCID:9060 Length:777 Species:Homo sapiens
Sequence 2:NP_476726.2 Gene:sl / 32601 FlyBaseID:FBgn0003416 Length:1236 Species:Drosophila melanogaster

Alignment Length:1250 Identity:274/1250 (22%)
Similarity:434/1250 (35%) Gaps:523/1250 (42%)


Human    25 AALNGRRLGLQDDEDLQALLKGSQLLKVKSSSWR--RERFYKLQEDCKTIWQE-SRKVMRTPESQ 86
            :|::...|| :.::.:..|.:|:.:.|:.....|  |.....::|..:.:|.. :.:..||....
  Fly     5 SAMSAPLLG-EMEQTIGMLERGTIVTKLYGKQRRPDRRHLMLIRETRQLLWATVATQTPRTDYEG 68

Human    87 LFSIEDIQEVRMGHRTEGLEKFARD---VPEDRCFSIV----FKDQRNTLDLIAPSPADAQHWVL 144
            ...:.:|:|:|:|..::....||.|   ....:||.|:    ||  ..:..::|.|..:|.:||.
  Fly    69 AIQLREIREIRVGKHSKEFRLFADDCQRFESSKCFVILHGNHFK--LKSFSVVALSEIEADNWVR 131

Human   145 GLHKIIHHSGSMDQRQKLQHWI------------HSCLRKADKNKDNKMSFKELQNFLKELNIQV 197
            ||..::..:.......::..|:            ||.  ||.:....:::.|:.:.||..::.::
  Fly   132 GLRYMVKDTLGAPYPLQIDRWLRREYYQIENVNTHSA--KATEQSPAQVTIKDFKLFLAGVSCKM 194

Human   198 DDSYARKIFRECDHSQTDSLEDEEIEAFYKMLTQRVEIDRTFAEA-AGSGET---LSVDQLVT-- 256
            ......:.|.| |..:...|:.::....|    |::.:...||.. :|||..   .|.||.|.  
  Fly   195 TTGKFMEHFTE-DVRRKHDLKFDDFSRLY----QKLLLPNGFASVLSGSGVANFPYSEDQQVVRP 254

Human   257 -----FLQHQQRE----EAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFSLAH 312
                 ||:.:||:    |.:..|:|..:.:..:..|....:..:|...|:.:|.|.....::..:
  Fly   255 AELKQFLETEQRDVSASEISSAAIASFIRDFVQDVERDVQEPYLTFPEFVDFLFSKQNDLWNSKY 319

Human   313 RRVYQDMGQPLSHYLVSSSHNTYLLEDQLAGPSSTEAYIRALCKGCRCLELDCWDGPNQEPIIYH 377
            .:|:.||..|||.|.::|||||||..||.:..||.|||.|||..||||:|||||:||:..|.|:|
  Fly   320 DQVFMDMNLPLSSYWIASSHNTYLTGDQFSSESSCEAYARALRMGCRCIELDCWNGPDNLPYIFH 384

Human   378 GYTFTSKILFCDVLRAIRDYAFKASPYPVILSLENHCTLEQQRVMARHLHAILGPMLLNRPLDGV 442
            |:|.||||.|.||::.|:|:||.:|.||||||:|.:|:|||||.||:.|..:.|.|||.:|.|..
  Fly   385 GHTITSKIKFMDVIKTIKDHAFTSSEYPVILSIEQNCSLEQQRNMAQALIEVFGDMLLTQPCDRN 449

Human   443 TNSLPSPEQLKGKILLKGKK----------------LGGLLPPGGEGG----------------- 474
            ...||||.||:.||:||.||                ||.....||.||                 
  Fly   450 EQHLPSPYQLRRKIILKHKKLPQFDDIANGISSTGSLGHRSSLGGAGGGAHGENDGENVRKVFKE 514

Human   475 ----------------------------------------------------------------- 474
                                                                             
  Fly   515 GLLYFKDPVDKSWNLYQFVLTHQELIYSSEINESRNGNSEDDDFGLSSSCSLNSNMQQKQKDTSA 579

Human   475 ----------------------------------------PEATVVSD----------------- 482
                                                    ..||.|.|                 
  Fly   580 NDELHFGENWFHGKLEGGRKEADDLLKKYKHFGDGTFLVRESATFVGDYSLSFWRRNRPNHCRIK 644

Human   483 ----------------------------------------------------ED----------- 484
                                                                ||           
  Fly   645 LKHENGSIKYYLVENFVFDSLYSLIVYYRKNMLRSSEFSIILKEPVPQPKKHEDQEWFHPNTTKE 709

Human   485 ----------------------------------------------------------------- 484
                                                                             
  Fly   710 QAEQGLYRLEIGSFLVRPSVQSINAFVISFTINRKIKHCRIMQEGRLYGIDTMNFESLVSLINYY 774

Human   485 -------------------------EAAEME---------------------------------- 490
                                     |||:.:                                  
  Fly   775 TRNPLYRNVKLSHPVSQELLRQALAEAAQGDHSGGHDDNGASNYMGSNLEENVTCKALYSYKANK 839

Human   491 -DE------AVRSRVQ-----------------HKP----------------------------- 502
             ||      |:.:.||                 |.|                             
  Fly   840 PDELSFPKHAIITNVQRDNSMWWIGDYGGMIKKHLPANYVKVIDSTTEDYNSLNEEGTDGRTDSI 904

Human   503 ----------------------------------------------------------------- 502
                                                                             
  Fly   905 EIFGAVASLFESNDPGIIFKLQIQTPTMQNPFVIGFDNQETAYEWIKAIQEAALIASQLASERRK 969

Human   503 KEDKLRLAQELSDMVIYCKSVHFGGFSSPGTPGQAFYEMASFSENRA-LRLLQESGNGFVRHNVG 566
            ||...|:|:|:||::||.:||.|...|      ..|.||:||.|.:| .:..|::...|:.::..
  Fly   970 KERTARVAKEMSDLIIYFRSVPFREHS------WIFQEMSSFPETKAEKQFFQQNTQLFLSYHRN 1028

Human   567 HLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYQGRFQDNGACGYVLKPAFLRD 631
            .:||:||.|.|.||||::|:..||.|.|::|||:||....|.:.|.:|::||.|||:|||:|:: 
  Fly  1029 QISRVYPKGQRLDSSNFNPMPFWNVGSQMIALNYQTGDKAMQLNQAKFRNNGQCGYILKPSFMK- 1092

Human   632 PNGTFNP-RALAQGPWWARKRLNIRVISGQQLPKVNKNKNSIVDPKVTVEIHGVSRDVASRQTAV 695
             :.:||| ..|..|  .:..:::||:|:.:.|.:..|:.|    |::.||:.|.|.|...:....
  Fly  1093 -SDSFNPNNPLCDG--LSEVKVSIRLIAARHLFRGGKSNN----PQIVVELIGASFDTGVKYRTK 1150

Human   696 ITNNGFNPWWDTEFAFEVVVPDLALIRFLVEDYDASSKNDFIGQSTIPLNSLKQGYRHVHLMSKN 760
            :..|||||.|:....|.|..|..|::||.|:|.|..::..||.|:..||..::||||.|.|.:|.
  Fly  1151 VNENGFNPVWNESCEFNVRNPQFAILRFEVQDEDMFAETHFIAQACYPLTCIRQGYRSVILRNKF 1215

Human   761 GDQHPSATLFVKISL 775
            .::...::|.:.|.:
  Fly  1216 SEELELSSLLINIKI 1230

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PLCD1NP_001124436.1 PH_PLC_delta 43..160 CDD:270169 28/127 (22%)
PH 51..151 CDD:278594 26/110 (24%)
EF-hand_10 180..229 CDD:291454 8/49 (16%)
PLN02228 233..776 CDD:177873 229/1020 (22%)
EF-hand_like 234..316 CDD:286375 22/97 (23%)
PI-PLCc_delta 316..617 CDD:176535 152/762 (20%)
C2_PLC_like 650..776 CDD:175974 41/126 (33%)
slNP_476726.2 PH_PLC_gamma 22..147 CDD:270168 28/127 (22%)
PI-PLCc_gamma 323..>470 CDD:176534 85/147 (58%)
SH2_N-SH2_PLC_gamma_like 584..682 CDD:199829 4/98 (4%)
SH2_C-SH2_PLC_gamma_like 696..796 CDD:198186 2/100 (2%)
SH3_PLCgamma 828..880 CDD:212759 7/52 (13%)
PLCYc 981..1091 CDD:128454 49/116 (42%)
C2_PLC_like 1109..1215 CDD:175974 39/110 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R928
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.