DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP6V1C1 and VMA5

DIOPT Version :8

Sequence 1:NP_001686.1 Gene:ATP6V1C1 / 528 HGNCID:856 Length:382 Species:Homo sapiens
Sequence 2:NP_012843.1 Gene:VMA5 / 853782 SGDID:S000001563 Length:392 Species:Saccharomyces cerevisiae

Alignment Length:392 Identity:139/393 (35%)
Similarity:215/393 (55%) Gaps:46/393 (12%)


Human     7 ISAPGEKTCQQTWEKLHAATSKNNNL----AVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEG 67
            ::|||.||  .:|        .|..|    |..|.|.||:.|:|:||.|:..|:||:|:|..:..
Yeast    23 VTAPGSKT--DSW--------FNETLIGGRAFVSDFKIPEFKIGSLDTLIVESEELSKVDNQIGA 77

Human    68 VVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQI 132
            .:.|:.:.:.. |.::.......|..|.:.:..|:..|||...|:.:.:|:|::..:|:...:|:
Yeast    78 SIGKIIEILQG-LNETSTNAYRTLPINNMPVPEYLENFQWQTRKFKLDKSIKDLITLISNESSQL 141

Human   133 DNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDW 197
            |.|:::..:.||:.|.||...|||..|.|..|||.:|||.:||||:||:|.|:||.|||...:|:
Yeast   142 DADVRATYANYNSAKTNLAAAERKKTGDLSVRSLHDIVKPEDFVLNSEHLTTVLVAVPKSLKSDF 206

Human   198 IKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADK 262
            .|.||||::.|||.|::|::||.:..|.||.||:|.|.:|...|||.|||.|:|.|:||.:...|
Yeast   207 EKSYETLSKNVVPASASVIAEDAEYVLFNVHLFKKNVQEFTTAAREKKFIPREFNYSEELIDQLK 271

Human   263 EEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKT 327
            :|.:..::.::.....|||..|..:.:.||.|.|:|||||:||||||||||.:|...::....|.
Yeast   272 KEHDSAASLEQSLRVQLVRLAKTAYVDVFINWFHIKALRVYVESVLRYGLPPHFNIKIIAVPPKN 336

Human   328 LKKLREVLHELYKHLDSSA-------------------AAIIDAPMDIPGLNLSQQEYYPYVYYK 373
            |.|.:..|.:.:..|..:|                   |:::|.            ||.|:|.|.
Yeast   337 LSKCKSELIDAFGFLGGNAFMKDKKGKINKQDTSLHQYASLVDT------------EYEPFVMYI 389

Human   374 ID 375
            |:
Yeast   390 IN 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP6V1C1NP_001686.1 V-ATPase_C 5..370 CDD:308707 136/386 (35%)
3-helical coiled coil 56..76 CDD:270211 5/20 (25%)
3-helical coiled coil 121..147 CDD:270211 6/26 (23%)
3-helical coiled coil 275..306 CDD:270211 15/31 (48%)
VMA5NP_012843.1 COG5127 6..392 CDD:227456 139/393 (35%)
3-helical coiled coil 66..86 CDD:270211 5/20 (25%)
3-helical coiled coil 130..156 CDD:270211 6/26 (23%)
3-helical coiled coil 284..315 CDD:270211 15/31 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C34193984
eggNOG 1 0.900 E1_COG5127
Hieranoid 1 1.000
Homologene 1 1.000 H1281
Inparanoid 1 1.050 228 1.000 Inparanoid score I827
Isobase 1 0.950 0 Normalized mean entropy S922
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001431
OrthoInspector 1 1.000 T1003900
orthoMCL 1 0.900 OOG5_127946
Panther 1 1.100 LDO PTHR10137
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1630
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.