DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP6V1C1 and Vha44

DIOPT Version :8

Sequence 1:NP_001686.1 Gene:ATP6V1C1 / 528 HGNCID:856 Length:382 Species:Homo sapiens
Sequence 2:NP_001137679.1 Gene:Vha44 / 36826 FlyBaseID:FBgn0262511 Length:836 Species:Drosophila melanogaster

Alignment Length:831 Identity:247/832 (30%)
Similarity:316/832 (38%) Gaps:451/832 (54%)


Human     1 MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFV 65
            |:|:|:|||||:||||||::.::..|||.:||....||:||||||||||.||||||:|.|||.:|
  Fly     2 MSEYWIISAPGDKTCQQTYDTMNNLTSKQHNLCNNYKFHIPDLKVGTLDQLVGLSDDLGKLDTYV 66

Human    66 EGVVKKVAQYMADVLEDSKDKVQENLLANG----------------------------------- 95
            |.:.:|||.|:.:||||.:||:.|||:||.                                   
  Fly    67 EQITRKVANYLGEVLEDQRDKLHENLMANNSPGPPDDSMPCRHHQRIKHLSLRHQRKHQHTHHQN 131

Human    96 ----------------------------------------------------------------- 95
                                                                             
  Fly   132 KPQHYHHHHHHHQLPQDLKGKSAATCSPATPPAPASAPPHLPPACACDVLAPGSLTGGSLTNLST 196

Human    96 ----------------------------------------------------------------- 95
                                                                             
  Fly   197 SHEPEPEFDVCPCDECFACAPPSTSATASTLLADECYSQTASSMLSATRCALSTVAAIATGSGLG 261

Human    96 ----------------------------------------------------------------- 95
                                                                             
  Fly   262 NGPSTSAAAAAAASNSSGGGGGGGPASCSTLCSSAYFSTSAPTTSSSVHSSMSRSNSKRLNNNTC 326

Human    96 ----------------------------------------------------------------- 95
                                                                             
  Fly   327 SINNNKLSFRSGSHVSQLHLATQQPQHHHSHPHQQPHTNPLQSPVQKSMSEDEGDASNAHEDGET 391

Human    96 ----------------------------------------------------------------- 95
                                                                             
  Fly   392 DEDPKSPHSVQSDLSDAFDWWFNKPKRNSKKSSAQQQHETAQLQHQQTTQQHATPLTPQNHNQYQ 456

Human    96 ----------------------------------------------------------------- 95
                                                                             
  Fly   457 NQHLSKAMTFWHQASTTPRSSYRSFFNSLADQIYSKRSTPSQLNINNGFNLTPTHRSSPVSSCCG 521

Human    96 -----------------------VDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLK 137
                                   .:|..|:||||||||||||||||:||::||:|.:.|||.|||
  Fly   522 SSSQGRSSPDTDPAEPPEFPLSPAELPQYLTRFQWDMAKYPIKQSLRNIADIISKQIGQIDGDLK 586

Human   138 SRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYE 202
            :::.|||||||||||||:|..||||||:||::|||:.|:||||||.||||:|||:..|||:..||
  Fly   587 TKSQAYNNLKGNLQNLEKKKTGSLLTRNLADLVKKEHFILDSEYLTTLLVIVPKVMANDWLTNYE 651

Human   203 TLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNR 267
            .:.:|:|||||.::.||.|..|.|||||:|..::|:..|||.|||||||.|||||:.|.|.||.:
  Fly   652 KITDMIVPRSSQLIQEDADYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELAAGKNEMTK 716

Human   268 LSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLR 332
            |.||||||||||||||||||||||.|.||||||||||||||||||||||||:|::||||::|:||
  Fly   717 LMTDKKKQFGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLR 781

Human   333 EVLHELYKHLDSSAA--AIIDAP-MDIPGLNLSQQEYYPYVYYKIDCNLLE 380
            :||::||.|||.::|  |:..|. :|||||...|.||:|||:||::.:::|
  Fly   782 DVLNQLYGHLDGASAGGAVSSADNVDIPGLGFGQSEYFPYVFYKVNIDMVE 832

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP6V1C1NP_001686.1 V-ATPase_C 5..370 CDD:308707 241/816 (30%)
3-helical coiled coil 56..76 CDD:270211 11/20 (55%)
3-helical coiled coil 121..147 CDD:270211 15/26 (58%)
3-helical coiled coil 275..306 CDD:270211 29/31 (94%)
Vha44NP_001137679.1 V-ATPase_C 6..>98 CDD:301617 56/92 (61%)
3-helical coiled coil 57..77 CDD:270211 11/20 (55%)
V-ATPase_C <547..822 CDD:281248 185/275 (67%)
3-helical coiled coil 570..596 CDD:270211 15/26 (58%)
3-helical coiled coil 724..755 CDD:270211 29/31 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C34172314
eggNOG 1 0.900 E1_COG5127
Hieranoid 1 1.000
Homologene 1 1.000 H1281
Inparanoid 1 1.050 519 1.000 Inparanoid score I1263
Isobase 1 0.950 0 Normalized mean entropy S922
OMA 1 1.010
OrthoDB 1 1.010 D1016088at2759
OrthoFinder 1 1.000 FOG0001431
OrthoInspector 1 1.000 T609581
orthoMCL 1 0.900 OOG5_127946
Panther 1 1.100 LDO PTHR10137
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1630
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.