DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP6V1C1 and Atp6v1c1

DIOPT Version :8

Sequence 1:NP_001686.1 Gene:ATP6V1C1 / 528 HGNCID:856 Length:382 Species:Homo sapiens
Sequence 2:NP_001011992.1 Gene:Atp6v1c1 / 299971 RGDID:1311082 Length:382 Species:Rattus norvegicus

Alignment Length:382 Identity:374/383 (98%)
Similarity:382/383 (100%) Gaps:0/383 (0%)


Human     1 MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFV 65
            ||||||||||||||||||||||||||:|||||||:||||||||||||||||||||||||||||||
  Rat     1 MTEFWLISAPGEKTCQQTWEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELAKLDAFV 65

Human    66 EGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVT 130
            ||||||||||||||||||||||||||||:||||||||||||||||||||||||||||||||||||
  Rat    66 EGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVT 130

Human   131 QIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHN 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   131 QIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHN 195

Human   196 DWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKA 260
            |||||||||||||||||||||||||||||||||||:|||||||||||||||||||||||||||:|
  Rat   196 DWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFKKAVDDFRHKARENKFIVRDFQYNEEEMRA 260

Human   261 DKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNK 325
            ||||||||||||||||||||||||||||||||||||:||||||||||||||||||||||||||||
  Rat   261 DKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAMLLQPNK 325

Human   326 KTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK 382
            |::||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   326 KSVKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP6V1C1NP_001686.1 V-ATPase_C 5..370 CDD:308707 357/365 (98%)
3-helical coiled coil 56..76 CDD:270211 20/20 (100%)
3-helical coiled coil 121..147 CDD:270211 26/26 (100%)
3-helical coiled coil 275..306 CDD:270211 30/31 (97%)
Atp6v1c1NP_001011992.1 V-ATPase_C 5..370 CDD:281248 357/365 (98%)
3-helical coiled coil 56..76 CDD:270211 20/20 (100%)
3-helical coiled coil 121..147 CDD:270211 26/26 (100%)
3-helical coiled coil 275..306 CDD:270211 30/31 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C33541916
eggNOG 1 0.900 E1_COG5127
HGNC 1 1.500
Hieranoid 1 1.000
Homologene 1 1.000 H1281
Inparanoid 1 1.050 749 1.000 Inparanoid score I7906
OMA 1 1.010
OrthoDB 1 1.010 D1016088at2759
OrthoFinder 1 1.000 FOG0001431
OrthoInspector 1 1.000 T2470083
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10137
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1313.370

Return to query results.
Submit another query.