DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP6V1C1 and vha-11

DIOPT Version :8

Sequence 1:NP_001686.1 Gene:ATP6V1C1 / 528 HGNCID:856 Length:382 Species:Homo sapiens
Sequence 2:NP_001023451.1 Gene:vha-11 / 177017 WormBaseID:WBGene00006920 Length:384 Species:Caenorhabditis elegans

Alignment Length:378 Identity:213/379 (56%)
Similarity:286/379 (75%) Gaps:4/379 (1%)


Human     3 EFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEG 67
            |:||||.||||.....|:||:.:|   .|.:..||:.||||||||||.||||||:|:|||...|.
 Worm     8 EYWLISVPGEKGANDAWDKLNRST---GNTSTNSKYLIPDLKVGTLDQLVGLSDDLSKLDTSAEA 69

Human    68 VVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQI 132
            |::|:.||..:|||:.|.|:.|||:....|:.||:|:|||:.||||:|||||.:||||.|.::||
 Worm    70 VIRKLVQYFTEVLEEDKSKIAENLVIGNKDMKTYVTKFQWEGAKYPLKQSLKVLSEIIGKQISQI 134

Human   133 DNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDW 197
            |||||.::..|||||..|.:::||..|||||:.||::||.|||||:||||.|::|||||::..:|
 Worm   135 DNDLKVKSLTYNNLKNALASMDRKTVGSLLTKDLADLVKADDFVLNSEYLQTVIVVVPKISVKEW 199

Human   198 IKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADK 262
            .::|.||:.||||.||.:|:|:.:..|..||||:|.:|:|::.|||||||||||.|:||.:||.:
 Worm   200 EQKYATLSSMVVPGSSKLLTEEGEHALYTVTLFKKVIDEFKNTARENKFIVRDFVYDEETLKAGR 264

Human   263 EEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKT 327
            .|.::|..:|::|:.||:||||:||.|.|.|:||:|||||||||||||||||||||.:::|.|..
 Worm   265 TERDKLMAEKQRQYAPLIRWLKINFGEIFAAYIHIKALRVFVESVLRYGLPVNFQAAVIEPAKGQ 329

Human   328 LKKLREVLHELYKHLDSSAAAIIDAPMDIPGL-NLSQQEYYPYVYYKIDCNLL 379
            .||||:.||:||.|||.|||..||...|.|.| :|...||||||::|::.:.|
 Worm   330 QKKLRQELHKLYIHLDGSAAGPIDTLEDSPALMSLGVNEYYPYVFFKLNIDFL 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP6V1C1NP_001686.1 V-ATPase_C 5..370 CDD:308707 209/366 (57%)
3-helical coiled coil 56..76 CDD:270211 10/20 (50%)
3-helical coiled coil 121..147 CDD:270211 16/26 (62%)
3-helical coiled coil 275..306 CDD:270211 22/31 (71%)
vha-11NP_001023451.1 V-ATPase_C 10..373 CDD:281248 209/366 (57%)
3-helical coiled coil 58..78 CDD:270211 10/20 (50%)
3-helical coiled coil 123..149 CDD:270211 16/26 (62%)
3-helical coiled coil 277..308 CDD:270211 22/31 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C34183727
eggNOG 1 0.900 E1_COG5127
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 437 1.000 Inparanoid score I1019
Isobase 1 0.950 0 Normalized mean entropy S922
OMA 1 1.010
OrthoDB 1 1.010 D1016088at2759
OrthoFinder 1 1.000 FOG0001431
OrthoInspector 1 1.000 T389724
orthoMCL 1 0.900 OOG5_127946
Panther 1 1.100 LDO PTHR10137
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1630
TreeFam 1 0.960
1413.750

Return to query results.
Submit another query.