DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PIGC and PIG-C

Sequence 1:NP_002633.1 Gene:PIGC HGNCID:8960 Length:297 Species:Homo sapiens
Sequence 2:NP_001350858.1 Gene:PIG-C FlyBaseID:FBgn0035435 Length:312 Species:Drosophila melanogaster

Alignment Length:288 Identity:108/289 (37%)
Similarity:164/289 (57%) Gaps:22/289 (8%)


Human     9 TKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFESSVVIQQLCSVCVFVVIWW 73
            :|...|.|.||..:.:||||.|..||::||.|:|.|.|.:...:...:|:..|:..:..|::::.
  Fly     7 SKRQPWVKNLYSNREYPDNYTDASFLKDLRTNLHCRIYTFGEAIAGITVLNNQISCITGFLILYQ 71

Human    74 YMDEGLLAPHWLLGTGLASSLIGYVLFDLIDGGEGRKKSGQTRWA----DLKSALVFITFTYGFS 134
            .|....::|..:|......:.|||:.:      .||..|    ||    |.|:.:..:.|.|.||
  Fly    72 LMLSDSVSPTTILVPSCGITGIGYLCY------RGRSLS----WALLGEDSKTLVTVVLFGYLFS 126

Human   135 PVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHA 199
            |:|.|||:::||||||.|:.|:|||:|||..||.:.|:||..:|||.|||.::|||||||.|.||
  Fly   127 PMLHTLTQAISTDTIYTMTFFVLLGNLIFGHYGLDVAMVSKAVSLNAAIFGAICLASRLPTSYHA 191

Human   200 FIMVTFAIQIFALWPMLQKKLKACTPRSYVGVTL-LFAFSAVGGLLSISAVGAVLFALLLMSISC 263
            |:::..|...|.|:|::.:      ...:.|..| :||...: .|..||.....|:|...:.|:.
  Fly   192 FVLLVEAAVFFVLYPIMTE------ANWHAGFMLPIFAICCM-ALYCISRPVLYLYASTTIFINF 249

Human   264 LCPFYLIRLQLFKENIHGPWDEAEIKED 291
            :|||..:..|.:|.|||||||||.::|:
  Fly   250 VCPFIFVWQQQYKFNIHGPWDEAIVEEN 277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PIGCNP_002633.1 GPI2 14..284 CDD:283969 103/275 (37%)
PIG-CNP_001350858.1 GPI2 12..270 CDD:310793 103/275 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C203164813
eggNOG 1 0.900 E1_KOG3059
Hieranoid 1 1.000
Homologene 1 1.000 H7109
Inparanoid 1 1.050 186 1.000 Inparanoid score I3886
Isobase 1 0.950 0 Normalized mean entropy S5235
OMA 1 1.010
OrthoDB 1 1.010 D1241278at2759
OrthoFinder 1 1.000 FOG0003253
OrthoInspector 1 1.000 T1075224
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12982
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R516
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.850

Return to query results.
Submit another query.