DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATP8B1 and CG33298

Sequence 1:NP_005594.2 Gene:ATP8B1 HGNCID:3706 Length:1251 Species:Homo sapiens
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1337 Identity:417/1338 (31%)
Similarity:631/1338 (47%) Gaps:326/1338 (24%)


Human    91 KYANNAIKTYKYNAFTFIPMNLFEQFKRAANLYFLALLILQAVPQISTLAWYTTLVPLLVVLGVT 155
            ::..|.|:|.||...:|||.||.|||.|.|||||:.:::|..||:||.......::|:|.|||||
  Fly   249 QFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPVLFVLGVT 313

Human   156 AIKDLVDDVARHKMDKEINNRTCEVIKDG---RFKVAKWKEIQVGDVIRLKKNDFVPADILLLSS 217
            |:|||.:|..|...||.|||.||.|. ||   |:|..||:|::|||::.|..|:.||||||||.:
  Fly   314 AVKDLFEDRRRRASDKRINNTTCRVY-DGETERYKKVKWQELRVGDIVHLSNNETVPADILLLRT 377

Human   218 SEPNSLCYVETAELDGETNLKFK---------MSLEITDQYLQREDTLATFDGFIECEEPNNRLD 273
            |:|..:||::|.:||||||||.:         .|:.:..:::.|          :|.:.|..:|.
  Fly   378 SDPQGVCYIDTCDLDGETNLKRREVVRGFEEMQSIFVPSKFVSR----------VEADAPTTKLY 432

Human   274 KFTGTLFW-RNTSFPLDADKILLRGCVIRNTDFCHGLVIFAGADTKIMKNSGKTRFKRTKIDYLM 337
            :|.|.|.. .....|:..:.:|||...::|||:..|:|::||.:||.|.|:...|:||::::..|
  Fly   433 RFHGALIHPTGERVPISTECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQM 497

Human   338 NY-MVYTIFVVLILLSAGLAIGHAYWEAQVGNSSWYLYDGEDDTPSYRGFLIFWGYIIVLNTMVP 401
            |. :::.:.::|||...| |||...|.:...:...........|.:.....|||.||::|..|:|
  Fly   498 NIDVIWCVIILLILCVVG-AIGCRMWLSSFTHFPVPYLPPNKLTANMESMWIFWTYIVILQVMIP 561

Human   402 ISLYVSVEVIRLGQSHFINWDLQMYYAEKDTPAKARTTTLNEQLGQIHYIFSDKTGTLTQNIMTF 466
            :||||::|:.::.|...|:.::.::.||.:...:.|...:.|:||||.:||:|||||||:|.|.|
  Fly   562 LSLYVTIELCKILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIF 626

Human   467 KKCCINGQIYGDHRDASQHNH--NKIEQVDFSW------------NTYADGKLAFYDHYLIEQIQ 517
            ::|.:||         |.:||  :::|:: :|.            |..:|........||....|
  Fly   627 RRCVVNG---------SDYNHPPSELEKI-YSKPGAPAPPLIPNDNLNSDMAQLTQGTYLTPHAQ 681

Human   518 SGKEPEVRQFFFLLAVCHTVMV------------------------------------------- 539
                 .:::|..:||:|:||:|                                           
  Fly   682 -----RIQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQRQKLLASSTST 741

Human   540 ---------------------DR------------------------------------------ 541
                                 ||                                          
  Fly   742 TTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPISSSAESSP 806

Human   542 ---------------------------------------------------------------TD 543
                                                                           .|
  Fly   807 NSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSSKTGTIYRTAD 871

Human   544 GQLNYQAASPDEGALVNAARNFGFAFLARTQNTITIS--ELGTERTYNVLAILDFNSDRKRMSII 606
            |:..|:|.||||.||||||.::....|.|:.|.|.:|  ..|..|.|.:|.:|.|:|.||.|||:
  Fly   872 GRPLYEAESPDELALVNAAYSYDCCLLNRSPNQILVSMPMAGATREYEILKVLPFDSSRKCMSIV 936

Human   607 VR-TPEGNIKLYCKGADTVIYERL----HRMNP---TKQETQDALDIFANETLRTLCLCYKEIEE 663
            || .....|.||.||||:.|...|    |. :|   .:::||..||.:|.|.||.|.:..:.:..
  Fly   937 VRQIGSQEIVLYTKGADSSIMPVLVPCSHN-SPEGILREQTQQLLDRYAREGLRILVMAKRTLNS 1000

Human   664 KEFTEWNKKFMAASVASTNRDEALDKVYEEIEKDLILLGATAIEDKLQDGVPETISKLAKADIKI 728
            .::|:|..:.....::..||:..|...:.::|.:|.|||||.|||:|||||||||:.|..|.|.:
  Fly  1001 ADYTDWWARHQEIEMSLENRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPETIASLLSAGISV 1065

Human   729 WVLTGDKKETAENIGFACELLTEDTTI----CYGED-----INSLLHARMENQRNRGGV-YAKFA 783
            |||||||.|||.||.::.:|.|:...:    ....|     ||..| ..|||.:....: |.:..
  Fly  1066 WVLTGDKPETAINIAYSAKLFTQQMELIRLTARSRDAAETAINFYL-TDMENDKTTSTLGYGQSL 1129

Human   784 PPVQESFFPPGGNRALIITGSWLNEILLEKKTKRNKILKLKFPRTEEERRMRTQSKRRLEAKKEQ 848
            ...|         |||::.|..|..||..|.       ||..|                      
  Fly  1130 RKKQ---------RALVVDGKTLTFILDPKS-------KLILP---------------------- 1156

Human   849 RQKNFVDLACECSAVICCRVTPKQKAMVVDLVKRYKKAITLAIGDGANDVNMIKTAHIGVGISGQ 913
                |:.|:..|::|:|||.||.|||.:|.:||......|||||||||||:||:.|.:|||||||
  Fly  1157 ----FLRLSKRCASVLCCRSTPLQKAYLVKVVKEELNLRTLAIGDGANDVSMIQMADVGVGISGQ 1217

Human   914 EGMQAVMSSDYSFAQFRYLQRLLLVHGRWSYIRMCKFLRYFFYKNFAFTLVHFWYSFFNGYSAQT 978
            |||||||::|::..:||||:||||.||.|.|.|:.:.:.||||||.||..:.|||..:.|:|.|.
  Fly  1218 EGMQAVMAADFTLPRFRYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQV 1282

Human   979 AYEDWFITLYNVLYTSLPVLLMGLLDQDVSDKLSLRFPGLYIVGQRDLLFNYKRFFVSLLHGVLT 1043
            ..:..::.|||:::||||.|.:|:.|:.|::.|.|:.|.||..|:..:.:....|::.||..:..
  Fly  1283 MMDQMYLMLYNLIFTSLPPLAIGVYDKRVAEDLLLKNPYLYKNGRLGVAYRPHDFWLILLDALYQ 1347

Human  1044 SMILFFIPLGAYLQTVGQDGEAPSDYQSFAVTIASALVITVNFQIGLDTSYWTFVNAFSIFGSIA 1108
            |:::||:.|.||       .|:......|..||.::.:........::...||.::..||..|:.
  Fly  1348 SLVIFFVALCAY-------AESDVGIWEFGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLG 1405

Human  1109 LY--FGIMFD---FHSAG-------IHVLFPSAFQFTGTASNALRQPYIWLTIILAVAVCLLPVV 1161
            .:  |.|::|   .:..|       |.|.|.||..              ||.|:|:..|.:||.:
  Fly  1406 SFYLFAIVYDSVCMNCFGVRSSYWVIFVCFASAVH--------------WLVIMLSTVVAVLPRL 1456

Human  1162 AIRFLSMTIWPSESDKI--QKHRKRLKAEE---QWQR 1193
            .:..:.:::.|.:|.|:  |..|:|.:.|.   .|.|
  Fly  1457 LLTTVRISLCPDDSTKVILQSKRERSRGEALLVTWSR 1493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP8B1NP_005594.2 P-type_ATPase_APLT_Dnf-like 94..1051 CDD:319770 380/1174 (32%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 24/50 (48%)
ATPase-Plipid 250..1473 CDD:273734 411/1315 (31%)
E1-E2_ATPase 302..>394 CDD:278548 49/93 (53%)
Cation_ATPase <880..965 CDD:289987 38/85 (45%)
HAD_like <1177..1240 CDD:304363 40/63 (63%)
PhoLip_ATPase_C 1223..1468 CDD:292829 82/266 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.