DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OAZ3 and Oda

DIOPT Version :9

Sequence 1:NP_057262.2 Gene:OAZ3 / 51686 HGNCID:8097 Length:235 Species:Homo sapiens
Sequence 2:NP_725104.1 Gene:Oda / 36307 FlyBaseID:FBgn0014184 Length:270 Species:Drosophila melanogaster


Alignment Length:249 Identity:62/249 - (24%)
Similarity:102/249 - (40%) Gaps:34/249 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     6 CRPSVYSLSYIKR---------GKTRNYLYPIWSPYAYYLYCYKYRITLREKMLPRCYKSITYKE 61
            |.| |:|..:::|         ||.|..   ..|..|..:....|||:|....|......:.::.
  Fly    25 CDP-VFSSGFVRREFNDSGIADGKLRTI---STSSCATTMSSESYRISLGVGPLWWSDVPVHHRT 85

Human    62 EED----LTLQPR--SCLQCSESLVGLQEGKSTEQGNHDQLKELYSAGNLTVLATDP-------- 112
            :.|    ||...|  |......||.......|:...:.....:|.|..::..|.:|.        
  Fly    86 DHDRASLLTGYSRKSSVDSAGGSLYEASSRASSLSSSQSDCSDLESQPDIHSLCSDDDCQEVLRQ 150

Human   113 -LLHQDPVQLDFHFRLTSQTSAHWHGLL--CDRRLFLDIPYQALDQGNRESLTATLEYVEEKTNV 174
             |.|..|||:.....:|.....:|:.:|  .:..|::.:|......|::::..:.||:.|||..|
  Fly   151 ILQHDQPVQITIKLHVTEDQYTNWNTILNPVNNLLYVALPKDLPPAGSKQTFISLLEFAEEKLEV 215

Human   175 DSVFVNFQNDRNDRGALLRAFSYMGFEVVRPDHPALPPL---DNV-IFMVYPLE 224
            |.:.:....|:.||..|:.||.:||||.:....|..||.   ||. .:.:|.:|
  Fly   216 DGIVMVMPKDQPDRARLIEAFLFMGFEPLSRKAPQAPPAAINDNENYYFLYSIE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OAZ3NP_057262.2 Cupredoxin <112..>139 CDD:302766 7/35 (20%)
ODC_AZ 132..223 CDD:280300 28/96 (29%)
OdaNP_725104.1 ODC_AZ 182..268 CDD:280300 26/85 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10668
eggNOG 1 0.900 - - E1_KOG4387
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5256
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403675at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40521
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.