DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: OAZ3 and Oda

Sequence 1:NP_057262.2 Gene:OAZ3 HGNCID:8097 Length:235 Species:Homo sapiens
Sequence 2:NP_725104.1 Gene:Oda FlyBaseID:FBgn0014184 Length:270 Species:Drosophila melanogaster

Alignment Length:249 Identity:62/250 (25%)
Similarity:102/250 (41%) Gaps:34/250 (14%)


Human     6 CRPSVYSLSYIKR---------GKTRNYLYPIWSPYAYYLYCYKYRITLREKMLPRCYKSITYKE 61
            |.| |:|..:::|         ||.|..   ..|..|..:....|||:|....|......:.::.
  Fly    25 CDP-VFSSGFVRREFNDSGIADGKLRTI---STSSCATTMSSESYRISLGVGPLWWSDVPVHHRT 85

Human    62 EED----LTLQPR--SCLQCSESLVGLQEGKSTEQGNHDQLKELYSAGNLTVLATDP-------- 112
            :.|    ||...|  |......||.......|:...:.....:|.|..::..|.:|.        
  Fly    86 DHDRASLLTGYSRKSSVDSAGGSLYEASSRASSLSSSQSDCSDLESQPDIHSLCSDDDCQEVLRQ 150

Human   113 -LLHQDPVQLDFHFRLTSQTSAHWHGLL--CDRRLFLDIPYQALDQGNRESLTATLEYVEEKTNV 174
             |.|..|||:.....:|.....:|:.:|  .:..|::.:|......|::::..:.||:.|||..|
  Fly   151 ILQHDQPVQITIKLHVTEDQYTNWNTILNPVNNLLYVALPKDLPPAGSKQTFISLLEFAEEKLEV 215

Human   175 DSVFVNFQNDRNDRGALLRAFSYMGFEVVRPDHPALPPL---DNV-IFMVYPLE 224
            |.:.:....|:.||..|:.||.:||||.:....|..||.   ||. .:.:|.:|
  Fly   216 DGIVMVMPKDQPDRARLIEAFLFMGFEPLSRKAPQAPPAAINDNENYYFLYSIE 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
OAZ3NP_057262.2 Cupredoxin <112..>139 CDD:302766 7/36 (19%)
ODC_AZ 132..223 CDD:280300 28/97 (29%)
OdaNP_725104.1 ODC_AZ 182..268 CDD:280300 26/86 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4387
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5174
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1403675at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T608963
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10279
Phylome 1 0.910 0.833 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.