DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DHRS7 and CG31937

Sequence 1:XP_016876857.1 Gene:DHRS7 HGNCID:21524 Length:404 Species:Homo sapiens
Sequence 2:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster

Alignment Length:327 Identity:114/328 (35%)
Similarity:175/328 (53%) Gaps:19/328 (6%)


Human     4 ELLLWLLVLCALLLLLVQLLRFLRADGDLTLLWAEWQGRRPEWELTDM---VVWVTGASSGIGEE 65
            |.||.||||..::.:|:.:|    .|.::.|    |...|....|:.|   |||:||||||||..
  Fly     5 EFLLLLLVLYYVVYVLLWIL----LDCNVAL----WYKSRFGVSLSSMRGQVVWITGASSGIGRA 61

Human    66 LAYQLSKLGVSLVLSARRVHELERVKRRCL--ENGNLKEKDILVLPLDLTDTGSHEAATKAVLQE 128
            ||..|::.||.|||||||:.:||:|:..||  ..|.|..||:||:.:|:.|...|:.....||..
  Fly    62 LALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNH 126

Human   129 FGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERK--QGKIVTVNSI 191
            |.|:|:||||.|.|||:...:..::|.|:|.||:....|.|::.|:.:.:|:.  :|.|...:||
  Fly   127 FHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSI 191

Human   192 LGIISVPLSIGYCASKHALRGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKTIGN 256
            .|...||.|..|||:||||..:...|:.|:..   :.||...|||:.::.::.:..|.....:|.
  Fly   192 AGFSPVPFSPTYCAAKHALNAYLLSLKVEMRK---LDVSLFAPGPIATDFLQEAFTGSQGGKVGL 253

Human   257 NGDQSHKMTTSRCVRLMLISMANDLKEVWISEQPFLLVTYLWQYMPTWAWWITNKMGKKRIENFK 321
            :.....:||..||..|..:::||.:...|....|..|:.|..: .||.:..:...|.:|.:...:
  Fly   254 STANQKRMTAQRCGDLFAVALANKMDLTWCGLFPVNLLAYCAR-NPTLSKILAQLMTEKTLNKIR 317

Human   322 SG 323
            .|
  Fly   318 EG 319

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DHRS7XP_016876857.1 None
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 94/252 (37%)
adh_short 47..245 CDD:278532 81/201 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C255473769
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 1 1.000
Homologene 1 1.000 H9350
Inparanoid 1 1.050 178 1.000 Inparanoid score I3974
Isobase 1 0.950 0 Normalized mean entropy S2709
OMA 1 1.010
OrthoDB 1 1.010 D429842at33208
OrthoFinder 1 1.000 FOG0006415
OrthoInspector 1 1.000 T1074636
orthoMCL 1 0.900 OOG5_131445
Panther 1 1.100 LDO PTHR44269
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5576
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.