DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PHF7 and pie

Sequence 1:NP_001308055.1 Gene:PHF7 HGNCID:18458 Length:381 Species:Homo sapiens
Sequence 2:NP_001260348.1 Gene:pie FlyBaseID:FBgn0005683 Length:582 Species:Drosophila melanogaster

Alignment Length:373 Identity:110/374 (29%)
Similarity:175/374 (47%) Gaps:54/374 (14%)


Human    33 CWLCLREPGDPEKLGEFLQKDNISVHYFCLILSSKLPQRGQSNRGFHGFLPEDIKKEAARASRKI 97
            |.:|.....|....||::...|:.||||||:||:.|||||..:.|..|||..||::|||.|.::.
  Fly     9 CLICKYSDTDDLVFGEWMIVRNLQVHYFCLLLSTHLPQRGGDSSGILGFLLRDIREEAAAAEKRK 73

Human    98 CFVCKKKGAAINCQKDQCLRNFHLPCGQERGCLSQFFGEYKSFCDKHRP----TQNIQHGHVGEE 158
            |:.|.|.||::.|  |:|...|||.||.|...:.:|.|:|||:|.|.||    .:.:|.......
  Fly    74 CWYCNKIGASLQC--DRCRSLFHLKCGLENRAVFEFCGQYKSYCYKCRPMDDYKRQLQSNPPRNA 136

Human   159 SCILCCEDLSQQSVE-NIQSPCCSQAIYHRKCIQKYAHTSAKHFFKCPQCNNRKEFPQEMLRMGI 222
            :|.:|...:.:..:. .:...||.....|:||:::||.||. ::.:|..|.:.: |...:....:
  Fly   137 TCPICFSSIYKVELHCVVYGDCCRLGFAHKKCMRQYALTSG-YYLRCIWCRSER-FRDSIRLQSV 199

Human   223 HIPDRDAAWELEPGAFSDLYQRYQHCDAPICLYEQGRDSFEDEGRWCLILCATCGSHGTHRDC-- 285
            .:|||||.||.:..|:.:|::|...||.|.||...||.  .:...|.::.|::|.:...|..|  
  Fly   200 FVPDRDATWEKQRNAYRELHERNLKCDQPNCLCPSGRT--YNRLSWVILCCSSCAATSAHLKCLV 262

Human   286 SSLRSNSKK----WECEEC---------SPAAATD--------------YIPENSGDIPCCSST- 322
            .:||...|:    ::|..|         .||..|:              |:.:...|....|.| 
  Fly   263 GALRLPKKRERTDFKCSMCLDVERRIAEGPARTTEETNADGDNQVDGSFYVQKLGPDAATRSLTQ 327

Human   323 ---FHPEEH----------FCRDNTLEENPGLSWTDWPEPSLLEKPES 357
               |..|:.          |.:..:...:..||.:...|..::|.|:|
  Fly   328 TPVFSEEDESERSSNITVIFSQPKSNATSERLSLSPPQEEMIVEIPDS 375

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PHF7NP_001308055.1 ePHD_PHF7_G2E3_like 33..144 CDD:277139 50/111 (45%)
PHD_PHF7_G2E3_like 247..300 CDD:276971 16/59 (27%)
pieNP_001260348.1 PHD_SF 9..117 CDD:304600 49/110 (45%)
PHD_SF 224..>260 CDD:304600 11/38 (29%)
PARM 318..>491 CDD:293666 12/59 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C63786319
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6144
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D110264at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T609869
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12420
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.