DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PHF7 and trx

Sequence 1:NP_001308055.1 Gene:PHF7 HGNCID:18458 Length:381 Species:Homo sapiens
Sequence 2:NP_476769.1 Gene:trx FlyBaseID:FBgn0003862 Length:3726 Species:Drosophila melanogaster

Alignment Length:350 Identity:70/350 (20%)
Similarity:115/350 (33%) Gaps:114/350 (33%)


Human    32 VCWLCLREPGDPEKLGEFLQKDNIS---------VHYFCLILSSKLPQRGQSNRGFHGFLPEDIK 87
            :|..|       .|.||.|..:...         ||..|.:.|:::.:.      ..|.| :::.
  Fly  1736 MCLFC-------RKSGEGLSGEEARLLYCGHDCWVHTNCAMWSAEVFEE------IDGSL-QNVH 1786

Human    88 KEAARASRKICFVCKKKGAAINCQKDQCLRNFHLPCGQERGCLSQFFGEYKSFCDKHRPTQNIQH 152
            ...||.....|.||..:||.:.|....|..::|.||.:...|  .|..:...:|..|....|...
  Fly  1787 SAVARGRMIKCTVCGNRGATVGCNVRSCGEHYHYPCARSIDC--AFLTDKSMYCPAHAKNGNALK 1849

Human   153 GHVGEESCILCCEDLSQQSVENIQSPCCSQAIYHRKCIQKYAHTSAKHFFKCPQCNNRKEF---P 214
            .: |..|       ::.:|...:..|...:....||.:.:.|               |.:|   .
  Fly  1850 AN-GSPS-------VTYESNFEVSRPVYVELDRKRKKLIEPA---------------RVQFHIGS 1891

Human   215 QEMLRMGIHIPDRDAAWELEPGAFSDLYQRYQHCDAPI---C--LYEQGRDSFEDEGRWCLI--- 271
            .|:.::|..:|           .|||.|:..    .||   |  ||...::.      |.::   
  Fly  1892 LEVRQLGAIVP-----------RFSDSYEAV----VPINFLCSRLYWSSKEP------WKIVEYT 1935

Human   272 ---------LCATCGSHGTHRDCSSLRSNSK----------KWECEECSPAAATDYIPEN----- 312
                     ...|....|.:........|||          :|.    :..|.:::: ||     
  Fly  1936 VRTTIQNSSSTLTALDVGRNYTVDHTNPNSKEVQLGMAQIARWH----TSLARSEFL-ENGGTDW 1995

Human   313 SGDIPCCSSTFHPEEHFCRDNTLEE 337
            ||:.|..:|...|:|     ||.||
  Fly  1996 SGEFPNPNSCVPPDE-----NTEEE 2015

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PHF7NP_001308055.1 ePHD_PHF7_G2E3_like 33..144 CDD:277139 27/120 (23%)
PHD_PHF7_G2E3_like 247..300 CDD:276971 12/80 (15%)
trxNP_476769.1 NR_DBD_like 762..>856 CDD:295381
PHD1_KMT2A_like 1268..1344 CDD:276981
PHD 1346..1390 CDD:214584
PHD3_KMT2A_like 1423..1479 CDD:276983
ePHD_KMT2A_like 1737..1841 CDD:277134 27/120 (23%)
FYRN 1891..1935 CDD:283589 13/65 (20%)
FYRC 3388..3476 CDD:197781
SET 3590..3710 CDD:214614
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.