DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PHF7 and Phf7

Sequence 1:NP_001308055.1 Gene:PHF7 HGNCID:18458 Length:381 Species:Homo sapiens
Sequence 2:NP_001259740.1 Gene:Phf7 FlyBaseID:FBgn0031091 Length:520 Species:Drosophila melanogaster

Alignment Length:389 Identity:119/390 (31%)
Similarity:176/390 (45%) Gaps:65/390 (17%)


Human    32 VCWLCLREPGDPEKLGEFLQKDNISVHYFCLILSSKLPQRGQSNRGFHGFLPEDIKKEAARASRK 96
            :|.|||....|....|....:.|:.||..||.|||.|.|||:.......||.|||:.|..|....
  Fly     4 ICVLCLSGERDELIFGTVHVEGNMMVHRNCLYLSSNLIQRGEKKLSIMNFLKEDIEAEVNRCRLL 68

Human    97 ICFVCKKKGAAINCQKDQCLRNFHLPCGQERGCLSQFFGEYKSFCDKH------RPTQNIQHGHV 155
            .|..|::.||.|.|.|..|.|.||..||.:....:||...|.|||.:|      ||.      ..
  Fly    69 KCCYCRRLGANIWCCKSGCRRTFHTKCGVDNLAQNQFCDTYNSFCHQHVLVPRNRPV------FK 127

Human   156 GEESCILCCEDLSQQS-----VENIQSPCCSQAIYHRKCIQKYAHTSAKHFFKCPQCNNRKEFPQ 215
            .:|.|:||.||:..:.     |..:.:|||....:||:|:|:||::|. :|||||.|||...| :
  Fly   128 NDEECLLCAEDVVAKGERFSVVTCLYAPCCRNGWFHRRCLQRYANSSG-YFFKCPLCNNTDVF-R 190

Human   216 EMLRMGIHIPDRDAAWELEPGAFSDLYQRYQHCDAPICLYEQGRDSFEDEGRWCLILCATCGSHG 280
            .:..|||.:.|:||:||.||.||:..|:|..:|.|.:|:...||    .:....|:.|.:||::.
  Fly   191 RVAYMGIAVLDQDASWETEPDAFAGQYRRDVNCTAALCVAVSGR----ADTSAMLLYCTSCGANP 251

Human   281 THRDCSSLRSNSKKWECEECS-------PAAATDYIPENSGDIPCCSSTFHPEEHFCRDNTLEEN 338
            :|..|:  ....:.:.|:.||       |.|.:|  .:::|.:...:....| .|...|...|:.
  Fly   252 SHYLCT--LKTLQNYVCKVCSAVSPEAVPVAESD--SDDAGSMDDSAEAPRP-GHLNGDQIQEKL 311

Human   339 PGLSWTDW----------------------------PEPSLLEKPESSRGRRSYSWRSKGVRIT 374
            ....|.|:                            |..|...:..:.||.|::  .|:|.:.|
  Fly   312 SPSHWDDFGSSDDDAVFQRAFDTKVQSRVVTLSDDQPSTSAGARALADRGTRTF--ESQGTQTT 373

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PHF7NP_001308055.1 ePHD_PHF7_G2E3_like 33..144 CDD:277139 44/111 (40%)
PHD_PHF7_G2E3_like 247..300 CDD:276971 12/53 (23%)
Phf7NP_001259740.1 ePHD_PHF7_G2E3_like 5..116 CDD:277139 44/111 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C63786253
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3963
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D110264at33208
OrthoFinder 1 1.000 FOG0011420
OrthoInspector 1 1.000 T610377
orthoMCL 1 0.900 OOG5_142332
Panther 1 1.100 O PTHR12420
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R10820
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.